Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001645-GRMZM2G058095
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274191
Function (paralog2):hypothetical protein LOC100191922

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.87830630939448
Log2 mRNA fold difference:-0.58232405292275
Log2 TE fold difference:-0.28394383481584
Sequences
Protein sequence

MAMEVRRRVPPPHGSAPRRQQATGGEGQRVRVQAGDALPLPIRHTNLIFSALFAASLVYL
MRRWREKIRSSTPLHVVSLAEIFAICGLVASLIYLLSFFGIAFVQSVVSNSDDEEDFIID
SRHGQARAPPPPAPAAPCALLGSPAAAPEKMPEEDEEIVAAVVAGKIPSYVLETRLGDCR
RAAGIRREALRRITGREMDGLPLDGFDYASILGQCCELPVGFVQLPVGVAGPLLLDGRRL
YVPMATTEGCLVASTNRGCKAIAESGGASSVVLKDGMTRAPAVRFPSARRAAELKAFLED
PANFDTLAMVFNRSSRFGRLQGVKCAIAGRNLYMRFSCSTGDAMGMNMVSKGVQNVLDYL
QADFPDMDVISISGNFCSDKKSAAVNWIDGRGKSVVCEAVIKEEVVKKVLKTNVQALVEL
NVIKNLAGSAVAGALGGFNAHASNIVAAIFIATGQDPAQNVESSQCITMLEAINDGKDLH
ISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGANRESPGSNARLLATVVAGAVLAGELS
LISAQAAGHLVKSHMKYNRSSKDMSKTLAEETDKPKKC*

MDMDVRRRVPPPHGSVPRRQQATGAEGERVRVQAGDALPLPIRHTNLIFSALFAASLVYL
MRRWRGKIRASTPLHVVSPAEIFAICGLVASLIYLLSFFGIAFVQSVVSSSDDDEDFIVD
SRHARARAPPTPAQTPCALLGSPAAATEKMPEEDEEIVAAVVAGKIPSYVLESRLGDCRR
AAGIRREALRRITGRDMDGLPLDGFDYASILGQCCELPVGYVQLPVGVAGPLLLDGRRLY
VPMATTEGCLVASTNRGCKAIAESGGASSVVFRDGMTRAPVVRFPSARRAAELKAFLEDP
ANFDTLAVVFNRSSRFGRLQGVKCAIAGRNLYMRFSCSTGDAMGMNMVSKGVQNVLDYLQ
ADFPDMDVISISGNFCSDKKSAAVNWIDGRGKSVVCEAVIKEEVVKKVLKTNVQALVELN
VIKNLAGSAVAGALGGFNAHASNIVAAIFIATGQDPAQNVESSQCITMLEAINDGKDLHV
SVTMPSIEVGTVGGGTQLASQSACLDLLGVKGANRESPGSNARLLATVVAGAVLAAELSL
ISAQAAGHLVQSHMKYNRSSKALAEETDKPKKC*

Other information
Ka divergence:0.494353KaKs divergence:0.0685921
GC content 1 (%):62GC content 2 (%):61GC content divergence:-0.008
Length 1 (bp):1737Length 2 (bp):1722Length divergence:-0.004
MFE 1 (kcal):-794.54MFE 2 (kcal):-784.07MFE divergence-0.007