Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001696-GRMZM5G870932
Species:maize
Duplication type:WGD
Function (paralog1):Phosphoenolpyruvate carboxykinase [ATP] (PEP carboxykinase)(PEPCK)(EC 4.1.1.49)(Phosphoenolpyruvate carboxylase)
Function (paralog2):hypothetical protein LOC100279748

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.99536277430684
Log2 mRNA fold difference:-1.9411685372749
Log2 TE fold difference:0.95451136262443
Sequences
Protein sequence

MATPNGLARIETTGKKKQDNGVWYDDSSAPVRAQTIDELHSLQRKRSAPSTPKRSAPTTP
IKGGAHSPFAVAISEEERHTQQMQSISASLASLTRETGPKVVKGDPAAKGEAAAQGAPST
PRAHQQHRHPAAPAIAVSDSSLKFTHVLNNLSPAELYEQAIKYEKGSFITSTGALATLSG
AKTGRSPRDKRVVKDEVTAQDLWWGKGSPNIEMDEKTFLINRERAVDYLNSLEKVFVNDQ
YLNWDPENRIKVRIISARAYHSLFMHNMCIRPTDEELEDFGTPDFTIYNAGQFPCNRYTH
YMTSSTSIDLNLARREMVIMGTQYAGEMKKGLFGVMHYLMPKRGILSLHSGCNMGKDGDV
ALFFGLSGTGKTTLSTDHNRLLIGDDEHCWSDNGVSNIEGGCYAKCIDLAQEKEPDIWNA
IKFGTVLENVVFDEHTREVDYADNSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACD
AFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPQATFSACFGAAFIMLHPTKYAA
MLAEKMQKYGATGWLVNTGWSGGRYGVGKRIRLPYTRKIIDAIHSGELLTANYQKTEVFG
LEIPTEINGVPSEILDPINTWTDKAAYKENLLRLGGLFKKNFEVFASYKIGDDSSLTDEI
LAAGPNF*

MATPNGLARIETNGATKPDNGVCHDDSSAPVRAQTIDELHSLQRKRSAPTTPIKDGAAST
FAAALSEEERHRQQLQSISASLASLTRETGPKVVKGDPARRGEAPATGAPPTPQAHHQHH
HPAAPTIAVSDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTGRSPR
DKRVVKDEVAARDLWWGKGSPNIEMDEHTFLTNRERAVDYLNSLDKVFVNDQFLNWDPEN
RIKVRIISARAYHSLFMHNMCIRPTDEELESFGTPDFTIYNAGQFPCNRYTHYMTSSTSV
DINLARREMVILGTQYAGEMKKGLFGVMHYLMPKRGILSLHSGCNMGKDGDVALFFGLSG
TGKTTLSTDHNRLLIGDDEHCWSENGVSNIEGGCYAKCIDLSQEKEPDIWNAIKFGAVLE
NVVFDEHTREVDYTDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPV
SKLDLAQTMYHFISGYTALVAGTEDGIKEPQATFSACFGAAFIMLHPTKYAAMLAEKMQK
YGATGWLVNTGWSGGRYGVGKRIRLPYTRKIIDAIHSGELLTANYQKTEVFGLEIPTEIK
GVPSEILDPINTWTDKAAYKETLLRLAGLFKKNFEVFASYKIGDDSNLTDEILAAGPNF*

Other information
Ka divergence:-0.43399KaKs divergence:-0.404788
GC content 1 (%):63GC content 2 (%):63GC content divergence:0
Length 1 (bp):2004Length 2 (bp):1980Length divergence:-0.006
MFE 1 (kcal):-851.11MFE 2 (kcal):-834.95MFE divergence-0.01