Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001918-GRMZM5G888263
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382028
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.90453857593795
Log2 mRNA fold difference:-0.75078593500577
Log2 TE fold difference:-0.16980649434966
Sequences
Protein sequence

MALASQGITLRSPPAGSGGHSGRRSSSVPAAAAPRGWGQPHAGQALSISPARYEPAARPP
WRGSLAAAIRAAASAGAHHGSDPVPAEPRIELPAIFTVFSEAAKTGAAFFIASSSAAFLL
GSFGGFGGGAGGLFGGGGGGGGWGAGGGGAGGGGGGDFWSWLFSAGAANADDKSSGDWDA
HGLPVNMTVPLTKLSGLKRYKLSELKFFDRAAAGGGAYTGPEDSFFEMVTLQPGGVYTKS
QLLKELETLVSCGMFERVDLEVKPKPDNTIGLTVSFVESVWSAAKQFKCINVGLMSQSGQ
VDFDQDMTEREKMDYLRKQERDYQQRVRGAKPCILPENVRGEVLGMMKKQEKVSARMLQK
IRDHVQKWYHNEGFVCAQVVNFGNLNTNEVVCEVVEGDITKVEYQFQDKLGNIVEGNTQL
QIIDRELPQQLRPGHIFNIGAGKQALKNINSLALFSNIEVNPRPDETKEGGIVVEIKLKE
LEPKSAEVSTEWSIVPGREGRPTLASIQPGGTVSFEHRNIYGLNRSIVGSVTSSNLLNPQ
DDLSFKLEYVHPYLDGVDDRSKNRTFKTSCFNTRKLSPVFVAGPNMDEAPPVWIDRVGFK
ANITESFTRQSKFTYGLVVEEITTRDETNTICTHGSRAMPSGGLSMDGPPTTLSGTGVDR
MAFLQANITRDNTEFVNGAIVGDRYIFQLDQGLGIGSKNPFFNRHQLTLTKFINLNKQEK
GAGKPLPAVLVLHSHYAGCVGDLPSYDAFALGGPYSVRGFSNGELGASRNILELATELRV
PIRNTHVYAFAEHGTDLGSSKDVKGNPTEFFRRVGHGSSYGVGVKLGLVRGEYIVDHNAG
TGTVFFRFGERF*

MDEAPPVWIDRVGFKANITESFTRQSKFTYGLVVEEITTRDETNTVCTHGSRAMPSGGLN
MDGPPTTLSGTGVDRMAFLQANITRDNTEFVNGAIVGDRYIFQLDQGLGIGSKNPFFNRH
QLTLTKFINLNKQEKGVGKPLPAVLVLHGHYAGCVGDLPSYDAFALGGPYSVRGFSNGEL
GASRNILEVATELRVPVRNTHVYAFVEHGTDLGSSKDVKGNPTEFFRRVGHGSSYGVGVK
LGLVRGE

Other information
Ka divergence:0.438171KaKs divergence:0.256198
GC content 1 (%):53GC content 2 (%):45GC content divergence:-0.082
Length 1 (bp):2559Length 2 (bp):741Length divergence:-0.551
MFE 1 (kcal):-992.1MFE 2 (kcal):-227.93MFE divergence-0.626