Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001930-GRMZM2G049229
Species:maize
Duplication type:WGD
Function (paralog1):Transcription factor MYC7E Fragment
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.0712225567759
Log2 mRNA fold difference:-1.7277305843918
Log2 TE fold difference:-0.28301681293477
Sequences
Protein sequence

MNLWTDDNASMMEAFMASADLPTFPWGAPAGGGNSSAAAASPPPPQMPAATAPGFNQDTL
QQRLQAMIEGSRETWTYAIFWQSSLDSATGASLLGWGDGYYKGCDEDKRKQKPLTPSAQA
EQEHRKRVLRELNSLISGAAAAPDEAVEEEVTDTEWFFLVSMTQSFLNGSGLPGQALFAG
QPTWIASGLSSAPCERARQAYNFGLRTMVCFPVGTGVLELGSTDVVFKTAESMAKIRSLF
GGGAGGGSWPPVQPQAPSSQQPAAGADHAETDPSMLWLADAPVMDIKDSLSHPSAEISVS
KPPPHPPQIHFENGSTSTLTENPSPSVHAPPPPPAPAAPQQRQHQHQNQAHQGPFRRELN
FSDFASTPSLAATPPFFKPESGEILSFGADSNARRNPSPVPPAATASLTTAPGSLFSQHT
ATMTAAAANDAKNNNKRSMEATSRASNTNHHPAATANEGMLSFSSAPTTRPSTGTGAPAK
SESDHSDLDASVREVESSRVVAPPPEAEKRPRKRGRKPANGREEPLNHVEAERQRREKLN
QRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLETDKETLQTQVEALKKERDAR
PPSHSAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELDLDVYH
ASVSVVKDLMIQQVAVKMASRVYTQDQLSAALYSRLAEPGSAMGR*

MNLWTDDNASMMEAFMASADLPAYPWGAPAGGGNPPPPQMPPAMAMAPGFNQDTLQQRLQ
AMIEGSRETWTYAIFWQSSLDAATGASLLGWGDGYYKGCDDDKRRHRPPLTPAAQAEQEH
RKRVLRELNSLISGGASAAPAPAPDEAVEEEVTDTEWFFLVSMTQSFLNGSGLPGQALFA
GHHTWIAAGLSSAPCDRARQAYNFGLRTMVCFPVGTGVLELGSTDVVFQTAETMAKIRSL
FGGGPGGGSWPPVQPQAAPQQQHAAEADQAAETDPSVLWLADAPVVDIKDSYSHPSAAEI
SVSKPPPPPPPPQIHFENGSTSTLTENPSPSVHAPPAPPAPPQRQQQNQGPFRRELNFSD
FASNPSLAAAPPFFKPESGEILSFGVDSNAQRNPSPAPPASLTTAPGSLFSQSQHTATAA
ANDAKNNNNNNKRSMEATSLASNTNHHPAAAANEGMLSFSSAPTARPSAGTGAPAKSESD
HSDLDASVREVESSRVVAPPPEAEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY
ALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLESDRETLQAQVEALKKERDARPHPH
PAAGLGGHDAGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELDLDVYHAS
VSVVKDLMIQQVAVKMASRMYSQDQLSAALYSRLAEPGSVMGR*

Other information
Ka divergence:0.315551KaKs divergence:0.185514
GC content 1 (%):69GC content 2 (%):71GC content divergence:0.014
Length 1 (bp):2118Length 2 (bp):2112Length divergence:-0.001
MFE 1 (kcal):-1081.06MFE 2 (kcal):-1097.33MFE divergence0.007