Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G002002-GRMZM2G113232
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.49174270382153
Log2 mRNA fold difference:-0.81836323180339
Log2 TE fold difference:0.32113607944649
Sequences
Protein sequence

MGMVPNGLLPSASARVTRRLDPERWAVAEGRTAELIARIQPNAYSEGRRLAVYHYVQRLI
MNCLSCQVFTFGSVPLKTYLPDGDIDVTAFSNSEELKEIWANLVRDALEREEKNENAEFH
VKEVQYIQAEVKIIKCLVENIVVDISFNQVGGLCTLCFLEEIDNLISENHLFKRSIILIK
AWCFYESRILGAHHGLISTYALETLVLYIFHIFNNSFTGPLEVLYRFLEFFSNFDWEKFC
LSLWGPVPISSLPDMTAEPPRIDSGELLLNKSFLDTCSSAYGVVPHTQENHSQPFISKHF
NVIDPLRTNNNLGRSVSKGNFFRIRSAFAYGAKRLGKLLECPKEDLIGELNQFFTNTWIR
HGSGSRPDVPTPSIVDVRPLKVVPSVVSSSQRSVTSFKKKAENPKLHATQDNLRLNQDNL
TEDGHIYTDPSQPIHKSDIHYRNLPRAVNPSVSHVQHQKSYTAQGSAKVSEQLERNNSAG
LMQSERDKRVPNGLFVNDRNGQNRSRFARTRSSPELTDSSAEGFRGRRTNAVGMEKSLGV
DYSSRRNILVPEMSSNHSTKSSQDESVSSLNCLSHPSAAASDSNSVSSSYRDDNGFVMNE
ELPSVSESSDMHHDEQVLVNLMESVKLHGFNGQIQLPMQIPSHMSVAHPPLLAPTSFSQK
HLTGVPPANLIGTPWLPNMQFLHGFVPPPMAHYIHNPNFAPNIEDGTETEKPNTSDVNHD
AGKTWHEYGVGFSGQFDPEARDPHIYDIDGKEHLSLPNGVAGAPLERQMKFTVENNGVDD
ETYTGMFQNHTSREAAVDYSKRSGYVNVPSSHASSSKGKTLDSSPWDEMTAHTTRPPREK
WGKRSAFAAPATTTHVKTGWQMGNTTEHLSTEVNDGPRNGTVVPIITEASEIVTGSDSFS
TQSRTSQVPNDFDPSQIGMPNPVFAPFLIGSPQHRQADSSGLTFVPTGPPVPFVVLPFVS
GNSDGSGPQFERSEGIDQLPANTVGHFVGSLHDVHQQDSSATSTVSSSTMTEPSGDHKPD
ILNSDFVSHWHNLQYGRLCQNPRPMGPVLYPVPVPPMYLHGHATWDGPGRPAAPNVNWTQ
MVGGQRVFPVMPVQPATERTGVLQHYSEDTPRYRGGTGTYLPNPKVHFRDRHSNSRNYRG
GYNGDRGDYSDKEGSWVNSKQRNLNRGYGRSQSERSSMRSDRQTTDESQSDRQRRTYRTD
SYRHEASSQYLVQGQPFGSTSSMRKQGNTSHGVYTPPSTSSNGPSALSGPPGPPFFMVYS
YEQGSNHGATATSSEPIEFGSLGPLPAADGDDIPRSTRQIMANGFYGQRRGPYRGGSSHS
SPDQPSSPQPRRLVHLRENGLSLFIPSL*

MGMVPNGLLPSASAGMTRRLDPERWAVAEDRTAELIACIQPNVYSEGRRLAVYHYVQRLI
MNCLSCQVFTFGSVPLKTYLPDGDIDVTAFSNSEELKEIWANLVRDALEREEKDENAEFH
VKEVQYIQAEVKIIKCLVENIVVDISFNQVGGLCTLCFLEEIDNLISQNHLFKRSIILIK
AWCFYESRILGAHHGLISTYALETLVLYIFHIFNNSFTGPLEVLYRFLEFFSNFDWEKFC
LSLWGPVPISSLPDMTAIPPRMDSGELLLNKSFLDTCSSAYGVVPHTQENQGQPFVSKHF
NVIDPLRTNNNLGRSVSKGNFFRIRSAFAYGAKRLGKLLECPKEALIPELNQFFTNTWIR
HGSGSRPDVPIPSLVDVRPMKVVSSVVSSSQRSLAAFKKKVENPKLHVNQDNLRPNQDNL
TGVGDIHYRNLPRTVNPSVSHVQHQKSYTPQGNAKVSEQLERNNSDGLMQSARDKRVPNG
LFVNDRNGQNRSRFARTRSSPELTDSSTEGFRGRRTNAVGMEKSFGVDYSRRNILIPEVS
SNHSTKSSQDESVSSMNGSSHPSALAASDSNSVSSSFRDDNGFVMNEELPSVSESSDMHH
DEQVLANLMESMKLHGFNGQIQLPMQIPSHLSVAHPPLLAPTTYSQKHLAGVPPANLIGT
PWLPNMQFLHGFVPPMAHYIHNPNFAPNIEDGTETEKPNTSDVNHDAGKTWQEYGVGFSR
HFDPEARDPHFYGIDGKEHSSLPNGVPGAPLERQMKFTVENNVVGDETYTGMFQIHTGRE
PAVDYSKRSGYGNVPSSHASSSKGKTLDSSSWDEMTVNTTIPPRENWGKRPAFVAPATTT
HGNTGWQMGNITEHLAAEVNDGPRNGTVVPIITEASEIVTGSDSFSSKSRTSQVPNELDP
SQVGMPNPVFTPFLIGSPQHRQADSSGLTFVPTGPPVPFVVLPFVPGNNDGSGPQFERSE
GIDQLPANTVGQFFGSLNDVHQQDSSAISTVSSSTMTEPSGEHKPDILHSDFVSHWHNLQ
YGRLCQNPRPMGPVLYPVPVPPMYLQGHVPWDGPGRPAAPNVNWTQMVGGQRVFPVMPVQ
PATERTGVFQHYGEDAPRYRGGTGTYLPNPKVHFRDRHSNSRNYRGGYNGDRGDYNDKEG
SWINSKQRNPNRGYGRSQSERSGMRSDRQVTDESRSDRQRRTYRNDSYRHEASSQYLVQG
QPFGSTSSMRKPGNTVHGVYTPPSTYSNGTSALSGPPGPPFFMVYSYEQGSNHAASSSEP
IEFGSLGPLPAADGDDIPRSTRQVMPNGFYGQRRGRYRGGSSHSSPDQPSSPQPRR*

Other information
Ka divergence:0.115157KaKs divergence:0.239055
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):4047Length 2 (bp):3951Length divergence:-0.012
MFE 1 (kcal):-1257.34MFE 2 (kcal):-1258.78MFE divergence0.001