Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G002124-GRMZM2G112229
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.3737169806942
Log2 mRNA fold difference:-0.9437354648643
Log2 TE fold difference:-0.51823236930286
Sequences
Protein sequence

MAGPKPRKPDRMCKSKSDIAASTSSSAMAASTPRHHRSPRTTSTSFPEVSSYSTSSSFTA
SSLAAFRDSLPELPLLFTFQDLAAATANFSAAHRLVPAAPSSNSFRCALRGHPAAVFRRP
LRRDARDVAARLAALGHCHHAAIARLLGAAASPDRTTLFLAYELVPNASPLSVLLRNPKN
PSFTPLASWHSRLQLAVDVCDALYYVHLQADTVHNRLSASSVLVCGDGPLPRAKIAHFGA
ADLAGELPVEHKDDDDDGGGGGSRGSSGSGDNRRTRSRGRRIEGTRGYMAPELVAGGPPS
RRSDVFALGVVLLELVSGQEPVRYELLNRGTGEYERTSLIDTAAAAVAEGMRRWVDRRLR
DSFPVDAAQSLTTLALLCVAKDPLARPDMSRVAAKVSKLFLEAQEWAAKFKVPTDISISI
APRLPRLVFLAVDDVDVSEFWWSVQLLLLMMWMCLNSDGQFNEKTAAAAPIFFGQRQRPW
NQVA*

MVGPKPNRMCKSKSAIATSSPSPSMAAAAAASTPRHRRSPRTTATTSFPAASSYSTSSST
TVSSSAASLAALRDSLPELPLLFTFQDLAAATANFSSAHRLAPAAPSSSSNSFRCALRGH
PAAVFRRPLRRDARDVAARLAVLGHCHHAAIARLLGAAASPDRTTLFLAYELVPDASPLS
VLLRNPKNPSFTPLATWHSRLQLAADVCDALYYVHLQADTVHNRLSASSVLVCGDGPLPR
AKIAHFGAADLAGELPVEHKDDDGGSKGSGSGSHRRTSSRGRRIEGTRGYMAPELVAGGP
PSRRSDVFALGVVLLELVSGQEPVRYEIVNRGTGEYERTSLIDTAAAAVAEGGGEGMRRW
VDRRLRDSFPVEAAESLTALALRCVSKDPLARPDMSLVAAKVSKLFLEAQEWAAKFNVPT
DISISIAPR*

Other information
Ka divergence:-0.15713KaKs divergence:0.0523213
GC content 1 (%):69GC content 2 (%):73GC content divergence:0.028
Length 1 (bp):1455Length 2 (bp):1290Length divergence:-0.06
MFE 1 (kcal):-660.01MFE 2 (kcal):-615.92MFE divergence-0.035