Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G002178-GRMZM2G067225
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279433
Function (paralog2):allene oxide synthase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.55759047951567
Log2 mRNA fold difference:1.0641791954631
Log2 TE fold difference:-0.75307561277091
Sequences
Protein sequence

MATSVRGFSSALRDVPGSYGLPLVGAVRDRLDFYYFQGQDKYFESRVERYGSTVVRMNVP
PGPFMARDPRVVAVLDAKSFPVLFDMDKVEKRDLFTGTYMPSTSLTGGHRVCAYLDPSEP
THAKVKQLLFSLLLSRKDDVIPVFRSNFSSLLATVESDLAEGGKAEFNKLNDVTSFDFIG
EAYFGVRPSATDLGKGGPTKAAKWLIWQLHPLLTLGLPMVLEEPLLHTFHLPPFFVKGDY
GALYKYFSTVAKQALDTAEGLGLSREEACHNLLFATTFNSYGGLKVLFPGILANVASAGE
KLHERLVAEIRGAVAEAGGKVTLAAVEKMELAKSVVWESLRLDPPVKFQYGHAKKDLQVQ
SHDAVFQVKKGEMLFGYQPCATKDPRVFGATAKEFVPGRFLGEEGSKLLQYVYWSNGRET
ENPTVDNKQCPGKNFVVLVGRLFLVELFLRYDTFTADIGKDLLGSSVVFTSVTKATSGPG
SE*

MASSDHGSTTAPKDVPGSYGLPLVGAVRDRLDFYYFQGQDKYFESRVERYGSTVVRMNVP
PGPFMARDPRVVAVLDAKSFPVLFDMDKVEKKDLFTGTYMPSTSLTGGYRVCSYLDPSEP
THTKVKQLLFSLLLSRKDDVIPTFRSNFSSLLATVEAELAKGGKAEFNKLNDVTSFDFIG
EAYFGVRPSATELGKGGPSKAAKWLIWQLHPLVTLGLPMVLEEPLLHTFHLPPFLVKGDY
RALYKYFSTVAKQALDTAEGLGLSREEACHNLLFATTFNSYGGLKVLFPGLLANVASGGE
KLHERLVAEIRGAVADAGGKVTLAAVERMELAKSVVWESLRLDPPVKFQYGHAKKDLLVE
SHDAVFQVRKGEMLFGYQPCATKDPRVFGDTAGDFVPDRFLGEEGSKLLQYVYWSNGRET
DNPSVDNKQCPGKNFVVLVGRLLLVELFLRYDTFTAEVGKELLGTSVIFTGVTKATSGPG
SE*

Other information
Ka divergence:-0.199405KaKs divergence:-0.437608
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):1449Length 2 (bp):1449Length divergence:0
MFE 1 (kcal):-642.82MFE 2 (kcal):-668.31MFE divergence0.019