Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G002559-GRMZM2G021885
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.075911058835365
Log2 mRNA fold difference:1.2384524830127
Log2 TE fold difference:-1.168874085184
Sequences
Protein sequence

MSSRNRSAAASSAAPALRTPRRLKRRPVKASAPGPGSGRRSGPATPLLKWDVGGGGGRGE
GRKAGADEAGDAARARETKAKATEVSVRRLAAGVWRLRPPEAVAGGGSGVRVGVEHIPRH
LQVQLLKQNTSGHHQSSKNEVSSPISVLERKSGELHKGQLHATSAMLPVATMEKATKWEP
GDIKGMESHDAYLIASQLNLLDEHRDTAYVADLQMELQQARDRISAMETERRSAKKRLDH
LFKKLAEEKAAWRNREHEKVRAILEDMKADLDHEKKNRRRLEMINMKLVNELKEAKMSAK
QLLQEYETERKARELTEEVCNELAREVDEDKAEIEALKRDSQRLREEVDEERKMLQMAEV
WREERVQMKLVDAKLTLDAKYTQLSKLQQDVEAFIAACSTANGDVTVVEQAESIIQAIKS
VRAQDAEFRYEPPAASEDIFSIFEELRPSEEPVIKEIEPCYKNSSAKCEPEIQEVSPMTD
IFLEKKAKANSNKSPKDESDTEDGSSWETISHEDVQGSSGSPDGSEPSVSNKVCDGSIPW
KSRNGFERMESEKLKDESADACLTNMNQPKKKESAISKLWKSSRPKNSEICKKDAVETVN
ARSSNVRLSVGTYSTVESGIQEIGLSPPCVEQWSSPDSMNVQFNRGFKGCIEYPRMSQKH
SLKAKLMEARLESHKVQLRQVLKQKI*

MSSRNRSAASCAAPAAAPSLRTPRRLRRRPVKAAAPGPGGGGRRSGPATPLLKWDVGGRR
GEGTKAADEAGDAARARETKAREVSVRRLAAGVWRLRPPEAVAGAGAGGENRVRVGVEHI
PRHLQVQLLKQNTSGHHQSLKNEVSSPISVLERKSGELHKVQLHATSAMLPVATMEKATK
WEPGDIKGMESHDAYLIASQLNLLDEQQDTVYVAGLQMELQQARDRISELETERRSARKK
LDHLFKKLAEEKAAWRNREHEKVRAILEDMKADLDHEKKNRRRLEMINLKLVNELKEAKM
SAKQLLQDYETERKARELTEEVCNELAREVGEDKAEIEALKRDSLRLREELDEERKMLQM
AEVWREERVQMKLVDAKLTLDAKYTQLSRLQHVVEAFIAARSTANGDITVVEEAENIIQA
IKSVRAQGAEFRYEPPAASEDIFSIFEELRPSEEPVIKEIEPCYTNSSAKCESEIQQVSP
MTDIFLETKAKVYSNKSPKDESDAEDGSSWETISHEDMRGSSGSPDGSEPSVSNKISISW
NSRNGFEYRENEKLEDDLADAYLASMNQPKKKESAISKLWKSSRPKNSEVCKKDAVVETV
NARPSNARHSVGTYSTVESGIQETGLSPPSVEQWSSPDSMNIQFNRGFKGCIEYPRTSQK
HSLKAKLMEARMESQKIQLRQVLKQKI*

Other information
Ka divergence:-0.127414KaKs divergence:-0.188549
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):2061Length 2 (bp):2064Length divergence:0.001
MFE 1 (kcal):-774.55MFE 2 (kcal):-774.73MFE divergence0