Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G002617-GRMZM2G018823
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100144300
Function (paralog2):hypothetical protein LOC100191355

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.95884113214547
Log2 mRNA fold difference:-0.90017350516488
Log2 TE fold difference:-0.073101412969689
Sequences
Protein sequence

MHDRSHKPQPAEAGNGGPAGEGGGGNVDRVLFKNLVEMVPLVESLMDRRVNPAYSRRASL
VYTPAPPKKASDLKSVKLPQSVSAKKRRDPGDIAKKSTPDSNGDNGSVVPLSLSGAENMP
KDEVAVLSEQINDLQKKLLEKEEALRSAESSVTEMNAAYATIDELRRLVADKEALIRSTN
SQLHDAKIMLADKQASLEKLEWEVKMSNKKVEDLQGDMSNMGFEISSLMVFFEKISENVS
GDSYDDIIPSSYELETLQSMSEIDKIEVDKLDKERVTYAEALAAARENPDEEHLNIAAEA
RSRLQVLVL*

MHDRSHKPQPPEAGEGAGGGNVDRVLFKNLVEMVPLVESLMDRRVNSAYSRRTSLVYTPA
PPKKASELESVKLPQSVSAKKRRDPGDVSKKSTPDSNGDNGLVVPLSLSGAENKPKDDVA
GLREQVDYLQKKLLEKEEALRSAESLVTEMNAAYATIDELRRLVSDKEALIRSTNSQLHD
AKIMLADKQASVEKLEWEVKMSNKKVEDLQGDVSNMGFEISSLMAFFDKISENLSGDSYD
DTVPSSYELEAIQSTSEIDKIEVDKIEQERITYGEALAAARENPDEEHLNIAAEARSRLQ
VLVL*

Other information
Ka divergence:0.339552KaKs divergence:0.569547
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):930Length 2 (bp):915Length divergence:-0.008
MFE 1 (kcal):-332.2MFE 2 (kcal):-325.31MFE divergence-0.01