Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G002830-GRMZM2G007057
Species:maize
Duplication type:WGD
Function (paralog1):ubiquitin-conjugating enzyme X
Function (paralog2):hypothetical protein LOC100192735

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.67701069456852
Log2 mRNA fold difference:-0.63997343913868
Log2 TE fold difference:-0.078080107747937
Sequences
Protein sequence

MTRGENQESQTGNVPAASAAAPGPKPASAGGGKGAEGQSVVRRLQSELMALMMGGDPGVS
AFPEGDNMLHWVGTIDGSAGTAYEGTSYRLALAFTAEYPYKPPKVRFDTPCFHPNVDVHG
NICLDILQDKWSSAYDVRTILLSIQSLLGEPNNDSPLNTQAAALWANQEEFRKMVEKIYK
PAA*

MTRGENQESQTGNVSAASAAAPGPKPASAGAGKGAEGQSVVRRLQSELMALMMGGDPGVS
AFPEGDNMLHWVGTIAGSAGTAYEGTSYRLALAFTAEYPYKPPKVRFDTPCFHPNVDVHG
NICLDILQDKWSSAYDVRTILLSIQSLLGGNGSLLIARFLRLFGRSMDLVRRLRFSPTDY
DLFRAEQRLAAQHAGGGALGEPGRVQEDGGEALQGRRVEDSTRRRCRLRFFKHRSHLDRL
TWMVLLGWVPSLVL*

Other information
Ka divergence:0.85487KaKs divergence:0.580916
GC content 1 (%):67GC content 2 (%):64GC content divergence:-0.023
Length 1 (bp):552Length 2 (bp):765Length divergence:0.162
MFE 1 (kcal):-258MFE 2 (kcal):-341.9MFE divergence0.14