Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003076-GRMZM2G167101
Species:maize
Duplication type:TD
Function (paralog1):tobamovirus multiplication 3
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.2119342806986
Log2 mRNA fold difference:-2.1737996237861
Log2 TE fold difference:3.8761186182923
Sequences
Protein sequence

MRGLLAVEAAGAASVPASVLHGAVDWWRDVNESPLWQDRIFHALAVLYGIVSAVALVQLI
RIECRVPEYGWTTQKVFHFLNFLVNGVRSVVFVLRRNVQLVEPEIIQHVLLDMPGLAFFT
TYALLVLFWAEIYYQARAMSTDGLRPTFYWINGVVYAIQIILWLVLWWKPVRVMVILPKM
FFAGVSLFAALGFVLYGGRLFLMLQRFPVDSKGRRKKLQEVGYVTTICFSCFLIRCVMLC
LNSFDKEADLDVLNHPILNFLYYLLVEIVPSALVLFILRKLPPKRGITQYHPIH*

MRGLLAVEAAGAASVPASVLHGAVDWWRDVNESPLWQDRIFHALAVLYGIVSAVALVQLI
RIECRVPEYGWTTQKVFHFLNFLVNGGEPAFVPLAILSFC*

Other information
Ka divergence:1KaKs divergence:-0.791873
GC content 1 (%):49GC content 2 (%):61GC content divergence:0.109
Length 1 (bp):885Length 2 (bp):303Length divergence:-0.49
MFE 1 (kcal):-301.02MFE 2 (kcal):-125.76MFE divergence-0.411