Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003304-GRMZM2G122076
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279599
Function (paralog2):homeodomain leucine zipper protein CPHB-5

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.368110102853
Log2 mRNA fold difference:2.0707533824665
Log2 TE fold difference:-0.69259213926317
Sequences
Protein sequence

MHPSAVSFDSGDGRRRGGAQMLLFGGGGSANSNGFFRGVPMAVLAMDDATRVGKRPFFTT
HEELLEEEYYDEQAPEKKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAV
WFQNRRARWKTKQLETDYDRLKAAYNALAADHQGLLADNDSLRAQVICLTEKLQGKETSL
SATIAAQEVDQPNEHTTGTEKLLAQQLKDDLHSSCGCTGHGALSSEEEDGGVVSDEGCNF
DLPDAMFAVGVTNHGAEEAQLANWTSWFWN*

MDPSAVSFDSGGTRRGGGAQMLLFGGGGSANSNGFFRGVPMAVLGMDDATRVGKRPFFTT
HEELLEEEYYDEQAPEKKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAV
WFQNRRARWKTKQLETDYDRLKAAYDALAADHQGLLADNDNLRAQVISLTEKLQGKETYP
SATTAAQEVDQPDEHTAVSGTEELLAQQLKDNLHSSGDCTGHGTLSSEEDDGGVVSDEGC
SFALPDAMFAAGFTHHGAEEVQLANWTSMFWN*

Other information
Ka divergence:-0.239276KaKs divergence:0.244563
GC content 1 (%):64GC content 2 (%):65GC content divergence:0.008
Length 1 (bp):813Length 2 (bp):819Length divergence:0.004
MFE 1 (kcal):-358.49MFE 2 (kcal):-373.9MFE divergence0.021