Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003385-GRMZM5G833389
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381658
Function (paralog2):2,3-bisphosphoglycerate-independent phosphoglycerate mutase (BPG-independent PGAM)(Phosphoglyceromutase)(EC 5.4.2.1)(PGAM-I)

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5327273650935
Log2 mRNA fold difference:-1.0549673513955
Log2 TE fold difference:-0.36723454898773
Sequences
Protein sequence

MASSWTLPDHPKLPKGKPVAVVVLDGWGEANPDQYNCIHVAQTPVMDSLKNGAPEKWRLV
KAHGTAVGLPSDDDMGNSEVGHNALGAGRIFAQGAKLVDQALASGKIYDGDGFNYIKESF
ENGTLHLIGLLSDGGVHSRLDQLQLLLKGVSERGAKKIRVHILTDGRDVLDGSSVGFVET
LENDLLELRGKGIDAQIASGGGRMYVTMDRYENDWDVVKRGWDAQVLGEAPYKFKSALEA
VKTLRAQPNANDQYLPPFVIVDDSGKAVGPVLDGDAVVTINFRADRMVMLAKALEYADFN
NFDRVRVPKIRYAGMLQYDGELKLPSRYLVSPPEIDRTSGEYLVKNGIRTFACSETVKFG
HVTFFWNGNRSGYFDETKEEYVEVPSDSGITFNVAPKMKALQIAEKARDALLSGKFDQVR
VNLPNGDMVGHTGDIEATVVACKAADEAVKIILNAVEQVGGIYLVTADHGNAEDMVKRNK
SGKPLLDKNGGIQILTSHTLQPVPVAIGGPGLHPGVKFRNDIQIPGLANVAATVMNLHGF
EAPADYEQTLIEVADN*

MGSSGFSWTLPDHPKLPKGKPVAVVVLDGWGEANPDQYNCIHVAQTPVMDSLKNGAPEKW
RLVKAHGTAVGLPSDDDMGNSEVGHNALGAGRIFAQGAKLVDQALASGKIYDGDGFNYIK
ESFESGTLHLIGLLSDGGVHSRLDQLQLLLKGVSERGAKKIRVHILTDGRDVLDGSSIGF
VETLENDLLELRAKGVDAQIASGGGRMYVTMDRYENDWDVVKRGWDAQVLGEAPYKFKSA
LEAVKTLRAQPKANDQYLPPFVIVDDSGNAVGPVLDGDAVVTINFRADRMVMLAKALEYA
DFDNFDRVRVPKIRYAGMLQYDGELKLPSRYLVSPPEIDRTSGEYLVKNGIRTFACSETV
KFGHVTFFWNGNRSGYFDATKEEYVEVPSDSGITFNVAPNMKALEIAEKARDALLSGKFD
QVRVNLPNGDMVGHTGDIEATVVACKAADEAVKIILDAVEQVGGIYLVTADHGNAEDMVK
RNKSGKPLLDKNDRIQILTSHTLQPVPVAIGGPGLHPGVKFRNDIQTPGLANVAATVMNL
HGFEAPADYEQTLIEVADN*

Other information
Ka divergence:-0.219169KaKs divergence:-0.692399
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1671Length 2 (bp):1680Length divergence:0.003
MFE 1 (kcal):-583.62MFE 2 (kcal):-605.73MFE divergence0.019