Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003424-GRMZM2G086614
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384253
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.61924627346304
Log2 mRNA fold difference:-1.3109306973542
Log2 TE fold difference:0.65034614267487
Sequences
Protein sequence

MDAYEATKVVFSRIQALDPDHAAKIMGLLLIQDHGEKEMIRLAFGPESLLHAVMAKARKD
LGLLLPASPTSVAAAGHAPFLQLPRQNSGRAGAPSPLSVSSPSSWSHAPVFSRSNSTSNG
TAEEAAGAGEELPSPVNGGAAPFFPRQAGDALLDDLQLQEQLAFLNEGGGNPAHQLLGFD
GGECRSPGPGDADGMFAFGLGWHNGGPAHRRSSSVNELCLGGGGGGGDGFGWKPCLYYAR
GFCKNGGSCRFVHGGLSDDAAALAGAKMEAAADQQQQCQDFLIRSKGQRLGPAAFPYSPT
GSLPGSPSAASKCLSFLLQQQQQQHDRAAAAASLMLGGGDEAHKFMARPRLDRADFASMM
NPGSRQIYLTFPADSTFREEDVSNYFSIYGPVHDVRIPYQQKRMFGFVTFVYPETVKLIL
AKGNPHFICDARVLVKPYKEKGKVPDKYRKQQQGDFSGCTTPTGGLDARDPFDLHQLGAR
MLQHSNSANELLLRRKLEEQQQAAELQHAIELQSRRLMGLQLLDLKARAAATASALPTPI
ANAFASSHPLSTMAVESPLESGEQLKLSSGFALDGKLNGGDKEESACEASPDAADSDQSG
EHNLPDSPFASPTKSAALVHDSFAATEPENTASCVGSKIDGGSNHLRPPALEIPSPSSYF
FPMRRLSSDHGAMGM*

MDAYEATKVVFSRIQALDPDHAAKIMGLLLIQDHGEKEMIRLAFGPESLLHAVMAKARKD
LGLLLPASPTSVAAAGHAPFLQLPRQNSGRAGAPSPLSVSSPSSWGHAPAFSRSNSTSNG
TGTAEEAAGAGEELPSPVNGGAAPFFPHQSGDALLDDLQLQEQLAFLNEGSANPAHQLPG
FVGGECRSPGPGDASGMFAFGLGWPNGGPAHRRSSSVNEFCLGGGGGGDGFGWKPCLYYA
RGFCKNGGSCRFVHGGLSDDAAAFAGAKMEAAADQQQQQQCQDFLIRSKSQRLGSAAFPY
SSTGSLPGSPSAASKCLSFLLQQQQQQHDRAAAAASLMLGGGDEAHKFMGRPRLDRADFA
NMMNPGSRQIYLTFPADSTFREEDVSNYFSIYGPVHDVRIPYQQKRMFGFVTFVYPETVK
LILAKGNPHFICDARVLVKPYKEKGKVPDKCRHALKPQQGDFSGCTTPTGGLDGGYPFDL
HQLGGRMLQHSSSANELLLRRKLEEQQQAIELQSRRLMGLQLLDLKARAAAAAASPLPTP
IGDAFASSQPVSTTAVESPSPPESGQQLLKLRSGFALEGKVNGGDKEESAREASPDAADS
DQSGGEHNLPDSPFASPTKSAALLHDSFTATETESTAASRVGVDAGVGSKIDGGSNHLRP
PALEIPSPSSYFFPMHRLSSDHGAMGM*

Other information
Ka divergence:0.110142KaKs divergence:0.117371
GC content 1 (%):66GC content 2 (%):65GC content divergence:-0.008
Length 1 (bp):2028Length 2 (bp):2064Length divergence:0.009
MFE 1 (kcal):-931.45MFE 2 (kcal):-954.17MFE divergence0.012