Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003466-GRMZM2G113060
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216971
Function (paralog2):hypothetical protein LOC100274117

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.52311123626065
Log2 mRNA fold difference:2.4679788410665
Log2 TE fold difference:-1.9882885951027
Sequences
Protein sequence

MAATTIDWHARNNAALPAAMYGVAVPDSKELVRALAPPTQQAPTISFAYPRSGVEQQSAA
GSFLGAGGSGLTPAQILQVQSRLQFLRRPAGAAVATQPMKRQGVPLPQAPAVSKLYRGVR
QRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDSAAFRLRGDSARLNFPELRRGGQH
LGPPLHAAVDAKLHAICNGTDVVVPLPQSRSNDATAAATATTAPSPFSSASPHVKSEPGS
SGSDSSFSADGDVSSTGSSDVVLDMQLLDFSEAPWDDSESFGLRKYPSLEIDWDSILLIS
*

MAATTIDWHGRNAALYGVPDSKELVRALAPPMQQAPTISFAYPCPGVEQQSQCAAAGSFL
GAGGLTPAQLLQVQSRLRFLRRPAAAGGAAQPMKRQGVPQQAPLPARPAVSKLYRGVRQR
HWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDGAAFRLRGDSARLNFPELRRGGQHLG
PPLHAAVDAKLHAICSGADVGAPLPQGQSQSHATAAATTATPSPFSSVSPHVKSEPGCSV
SESSFSADGDVSSTGSSDVVPEMQLLDFSEAPWDESDSFHLRKYPSLEIDWDSILIS*

Other information
Ka divergence:-0.0158051KaKs divergence:-0.727436
GC content 1 (%):69GC content 2 (%):71GC content divergence:0.014
Length 1 (bp):903Length 2 (bp):894Length divergence:-0.005
MFE 1 (kcal):-451.5MFE 2 (kcal):-460.71MFE divergence0.01