Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003506-GRMZM2G050159
Species:maize
Duplication type:WGD
Function (paralog1):membrane protein
Function (paralog2):membrane protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.8855317213082
Log2 mRNA fold difference:-1.7187916787138
Log2 TE fold difference:-0.14320309101965
Sequences
Protein sequence

MSRLLLLGAAVLLLASAATAQDCLSATFSGGRTFGRCNNLPSLSASLHWTYHPENGTADV
AFRAPSDASGWVAWGINPDRGGSMGGSSVFVASPSQDGSGAVSILMTHLESTSPSLTNNT
LKFKVPVGPAAEYSNGAYTIFATVELPGNSTQQFTVWQAGATSNGAISPHPTAPANLAST
QRLDFLSGSSTAASNSRLHRRNIHGMLNAIAWGVLIPVGAIIARYLRVFESADPAWFYLH
IACQCSGYILGVAGWGLGLKLGSESAGVTYQPHRSIGIAIFCLATLQVFALLLRPDKKNR
YRLYWNIYHHSVGYSVIVLGAVNIFKGLDILKPDSGYKTAYIVVLATLGGVALCLEAITW
PIAIRKRRRNAADKASNGNGWQQGA*

MIDHVNLERSRHTLSTSGSPVPNNRATTSSSPRAAITYSVAGLSLPHQLQLRPSLFAAFV
HQVSMARLLLLLLGASVLLLASAVTAQDCLSATFSGGRTFGKCNSLPSLSASLHWTYHPE
NGTADVAFRAPSDPSGWVAWGINPDSGGSMEGSSVFVASQDGSGAVSILMTNLESTSPSL
TNTTALKFKVPAGPAAEYSDRAYTIYATVELPRNSTQQFTVWQAGPATSNGGISPHPTAP
ANLASTQRLDFLSGSSTAAPNSKLHRRNIHGMLNAIAWGVLIPTGAIIARYLRVFESADP
AWFYLHIACQCSGYVLGVAGWGLGLKLGSESAGVTYQPHRSIGIAIFCLATLQVLALLLR
PDKKNKYRLYWNIYHHSVGYAVIVLSAVNIFKGLHILEPASGYKTAYIVILATLAGIALC
LEAITWPIAIRKRRRNADKASGGNGWQQGA*

Other information
Ka divergence:0.484593KaKs divergence:0.263158
GC content 1 (%):68GC content 2 (%):67GC content divergence:-0.007
Length 1 (bp):1158Length 2 (bp):1353Length divergence:0.078
MFE 1 (kcal):-543.26MFE 2 (kcal):-583.8MFE divergence0.036