Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003607-GRMZM2G161222
Species:maize
Duplication type:WGD
Function (paralog1):transposon protein
Function (paralog2):transposon protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.34310259611329
Log2 mRNA fold difference:0.30152540593063
Log2 TE fold difference:-0.69956423887652
Sequences
Protein sequence

MFNKIIKRGNRKGARGDNAEAAARPAAPSSSSGSGGGGAGAAAPVTVNHASRATAPSPSS
PTSPHVAPSALATNPAGAASPPLLEPLPLLRDVAAADRPGLFLRKLRIVAALFDLSDSLK
HPREKEAKRQALLELVDYVQAPAQAAGANAPTRLPDHVQEALVAAISANIFRPLPPALHE
SAAAIDPGAAPDEEEEPYLDPSWPHLQLVYELLLRYVVSPDTDTKVAKRYVDHAFVLRLL
DLFDSEDPREREYLKTVLHRIYGKFMVHRPFIRKAINNVFYRFIFETQRHNGIGELLEIL
GSIINGFALPMKEEHKLFLARALIPLHKPKSVAIYHQQLSYCIVQFVEKDYKLADTVIRG
LLKYWPVTNCQKEVLFLGELEEVLEATQPAEFQRCMVPLFKQIGRCLNSSHFQVAERALF
LWNNDHIVSLIAQNRVVIFPIIFEALERNIQSHWNQAVHGLTANVRKMFLDMDSELFEEC
QQQYMEKQAKAKEIQEQRESAWRQLEAVVAAKAAGDDMVLVN*

MFNKIIKRGNRKGARGDSAEVAARPAAPSSSSGSGGGGAGGAAPVTVNHASRATAPSPSS
PTSPHVTPSAFATNPAVGAASPPLLEPLPLLRDVAAADRPGLILRKLRLVAALFDLSDSL
KHPREKEAKRQALLELVDYVQAPAQAAGANAPTRLPDHVQEALVLAISANIFRPLPPALH
ESAAAIDPGAAPDDDEEPYLDPSWPHLQLVYELLLRYVVSPDTDTKVAKRYVDHAFVLRI
LDLFDSEDPREREYLKTVLHRIYGKFMVHRPFIRKAINNVFYRFIFETQRYNGIGELLEI
LGSIINGFALPMKEEHKLFLARALIPLHKPKSVVIYHQQLSYCIVEFVEKDYKLADTVIR
GLLKYWPVTNCQKEVLFLGELEEVLEATQPAEFQRCMVPLFKQIARCLNSSHFQVAERAL
FLWNNDHIVSLIAQNRGVIFPIIFEALERNIHSHWNQAVHGLTANVRKMFLDMDSELFEE
CQQQYMDKQAKAKEMQEQRESAWRQLEAVVAAKAAGDDMVLVN*

Other information
Ka divergence:0.359087KaKs divergence:0.146305
GC content 1 (%):58GC content 2 (%):57GC content divergence:-0.009
Length 1 (bp):1569Length 2 (bp):1572Length divergence:0.001
MFE 1 (kcal):-615.09MFE 2 (kcal):-617.62MFE divergence0.002