Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003625-GRMZM2G061742
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100384031
Function (paralog2):Rust resistance-like protein RP1-3

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.6956620789441
Log2 mRNA fold difference:-6.1354783907039
Log2 TE fold difference:4.4315711377657
Sequences
Protein sequence

MADLALVGLRWAASPIVKELLTKASAYLSVDMVREIERLQDTVLPQFELVIQAAQKSPHR
GKLESWLRRLKEAFYDAEDLLDEHEYNVLKAKAKSGKGPLLREDESSSTATTVMKPFHSA
MNRARNLLPGNRRLISKMNELKAILTEAKQLRDLLGLPHGNTTEWPAAAPTHVPTTTSLP
TSKVFGRNSDRDRIVKFLLGKTTTAEASSTKYSGLAIVGLGGMGKSTLAQYVYNDKRIEE
CFDVRIWICISRKLDVHRHTREIIESAKKGECPRVDNLDTLQCKLRDILQESQKFLLVLD
DVWFEKSHNETEWELFLAPLVSKQSGSKVLVTSRSETLPAAICCEQEHVIHLENMDDTEF
LALFKHHAFSGAEIKDQLLRMKLQDTAEEIAKRLGQCPLAAKVLGSRMCRRKDIAEWKAA
LKLGDLSDPFTSLLWSYEKLDPCLQRCFLYCSLFPKGHGYRPEELVHLWVAEGFIGSCNL
SRRTLEEVGMDYFNDMVSVSFFQRYGWYYVMHDILHDFAESLSREDCFRLEDDNVTEIPC
TVRHLSVRVESMQKHKEIIYKLHHLRTVICIDSLMDNASIIFDQMLWNLKKLRVLSLSFH
NSNKLPKSVGELKHLRYLDLNRTSVFELPRSLCALWHLQLLQLNGMVERLPNKVCNLSKL
RYLRGYKDQIPNIGKLTSLQQIYDFSVQKKQGYELRQLKDLNELGGSLHVQNLENVIGKD
EALASKLYLKSRLKELILEWSSENGMDAMNILHLDVLEGLRPPPQLSKLTIEGYRSDTYP
GWLLERSYFENLESFELSNCSLLEGLPPDTELVRNCSRLRINIVPNLKELSNLPVGLTDL
SIDYCPLLMFITNNELGQHDLRENIIMKADDLASKLALTWEVDSGKVRRVLSKDYSSLKQ
LMTLMMDDDISKHLQIIESGLEEREDKVWMKENIIKAWLFCHEQRIRFIYGRTMDMPLVL
PSRLCELSLSSCSITDEALAICLGGLTSLSNLKLKYNMALTTLPSEKVFEHLTKLDTLVV
TGCLCLKSMGGLRAAPSLSFFYCSDCPFLELARGAELMPLNLDGDLHIRGCILAADSFIN
GLPHLKHLSFDVCRSSPSLSIGHLTSLESLRLNGLPDLYSVEGLSALHLKYLTLQDVANH
TVKCISQFRVQESLTVSTSVLLNHMLMAEGFTVPPNLDLSYCKEPSVSFEEPANLSSVKC
LGFWYCKTESLPRNLKSLSSLESLSIGCCPNIASLPDMPSSLQRISIVNCPVLKKNCQEP
DGESWPKISHLRRTHINC*

MRPRFILFGVRSTISTACCVSCYFPVFPSRFTNFMRLSNPRFSPLRSGLYQLLAFCREKK
KKNSFPSFTHSTYILHLHVVHFAHKVRGSTNQYNFMADLALAGLRWTASPIVNELLTKAS
AYLSVDMVREIQRLEATVLPQFELVIQAAQKSPHRGILEGWLRRLKEAYYDAEDLLDEHE
YNVLEGKAKSGKSLLLGEHGSSSTATTVMKPFHAALSRARNLLPQNRRLLSKMNELKAIL
TEAQQLRDLLGLPHGNTVEWPAAAPTSVPTTTSLPTSKVFGRDRDRDHIVDFLLDKTTTA
QASSAKYSGLAIVGVGGMGKSTLAQYVYNDKRIEECFDVRMWVCISRKLDVHRHTREIME
SAKKGECPHVDNLDTLQCKLRDILQESHKFLLVLDDVWFEKSDTETEWELLLAPLVSKQS
GSKVLVTTRCETLPAAVCCEQVVHLKNLDDTEFLALFKHHAFSGAEIKDKLLHTKLEHTT
EEIAKRLGQCPLAAKVLGSRLCRKKDIAEWKAALKLGDLSDPFTSLLWSYEKLDPRLQRC
FLYCSLFPKGHRYEPNELVHLWVAEGFVGSCNLSRRTLEEAGMDYFNDMVSGSFFQLVSK
RHYSYYIMHDILHDLAESLSREDCFRLEDDNVTEIPCTVRYLSVRVESMQKHKEIIYKLH
HLRTVICIDSLMDNASIIFDQMLWNLKKLRVLSLSFYNSNKLPKSVGELKHLRYLDLTRT
SVFELPRSLCALWHLQLLQLNGMVERLPNKVCNLSKLRYLRGYKDQIPNIGKLTSLQQIY
VFSVQKKQGYELRQLKDLNELGGSLHVQNLENVIGKDEALASKLYLKSRLKELTLEWSSE
NGMDAMNILHLDVLEGLRPPPQLSKLTIKGYKSDTYPGWLLERSYFKNLERFELNNCSLL
EGLPPDTELLQHCSRLLLLDVPKLKTLPCLPPSLTKLSICGLPLLTFVTKNQLEQHDSRE
NIMMANHLASKLSLMWEVDSGSSVRSVLSKDYSSLKQLMTLMIDDDISKHLQIIESGLEE
GDKVWMKENIIKAWLFCHEQRIRFTYGRAMELQVVLPLGLCKLSLSSCNIIDEALAICLE
GLTSLATLELEYNMALTTLPSEEVFQHLTNLDMLILSGCWCLKSLGGLRVASSLSILHCW
DCPSLELARGAELMPLNLASNLSIRGCILAADSFINGLPHLKHLSIDVCRSSPSLSIGHL
TSLELLDLNGLPDLCFVEGLSSLHLKHLSLVDVANLTAKCISQFRVQESLTVSSSVLLNH
MLMAEGFTAPPNLTLLDCKEPSFSFEEPANLSSVKRLDFSLCEMESLPRNLKSLSSLESL
HIGRCPNVASLPDLPSSLQRIAIWCCPVLKKNCQEPDGESWPKISHLRWKHIY*

Other information
Ka divergence:-0.070442KaKs divergence:-0.0806178
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3837Length 2 (bp):4122Length divergence:0.036
MFE 1 (kcal):-1183.41MFE 2 (kcal):-1258.71MFE divergence0.031