Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003682-GRMZM2G123394
Species:maize
Duplication type:WGD
Function (paralog1):nematode-resistance protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.204639891403
Log2 mRNA fold difference:1.8108105696103
Log2 TE fold difference:0.40035546610112
Sequences
Protein sequence

MATPDLSPVSPVRRDDKQCAPSSSSCTILRVQDASAAEAYEQYLRLPELSSLWEAGCFPE
WASEGLVKPALQALEVTFRLASLALSDPRGYASRRELARRLESLAAREVGLVSALCEGDR
SAPLAELGASGGVLPRERSASEVWQLPGSAAAVVCQVSEASLLPRLAAWDKSETLAAKIM
YAIESQMQGCAFTLGLGEPNLAGKPVLEYDRVVRPHELHALKPKPAPEPKSGYLNRENET
LFTMYQILESWLRAASQLLARLNERIEAKNWEAAAADCWILERVWKLLADVEDLHLLMDP
DDFLRLKGQLAVRAAPWSDASFCFRSRALLHVANTTRDLKKRVPWVLGVEVDPNGGPRVQ
EAAMMLYHSRRRGEGEEAGKVELLQAFQAVEVAVRGFFFAYRQLVAAVMGTAEALGNRAL
FVPAEGMDPLAQMFLEPPYYPSLDAAKTFLADYWVQQMAGASAPSIQS*

MATPKLSPVSPVRQDGNDKPCAPSSPSSSPSTVLSAQDAYEQHLRLPELSSLWTAGCFPE
WAGEGLVKPALQALEVTFRLASLALSDPRGHAGRRELARRLESLAAREVELVSALCEGDG
RGAPLAELSASGGVLPRERSASEVVVWQLPGSAAAVVCRASEASLLPRLAAWEKSEALAA
RITYAVEGQMQGCAFTLGLGEPNLAGKPVLEYDRVVRPHELHALKPDPAPEPMSGYRNRE
LETLFTMYQILESWLRVASQLLTRLDERIEDKCWEAAAGDCWILERVWKLLADVEDLHLL
MDPDEFLRLKSQLAVRAAPGSESASFCFRSTALLHVASATRDLKKRVPWVLGVEADPSGG
PRVQEAAMKLYHSRRRGEGEEAGKVDLLQAFQAVEVAVRAFFFGYRQLVAAVMGTAEASG
NRALFVPAEEMDPLAQMFLEPPYYPSLDAAKTFLADYWVQLQQMAEASAPSRQS*

Other information
Ka divergence:0.223558KaKs divergence:0.3634
GC content 1 (%):69GC content 2 (%):71GC content divergence:0.014
Length 1 (bp):1407Length 2 (bp):1425Length divergence:0.006
MFE 1 (kcal):-707.36MFE 2 (kcal):-767.31MFE divergence0.041