Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003715-AC196475.3
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383037
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MALWALPVGFRFHPTDEELVSHYLKGKITGQINSEAEVIPEIDICKCEPWDLPGKSLIRS
DDPEWFFLAPKDRKYPNGSRSNRATVAGYWKATGPDRNIKSKGDKSKQFTIGKKKTLVFH
RGRAPKGERTGWIMHEYRTTEPQFESGKQGGYVLYRLFWKPEEKTERSSPKEMDRSGNSP
TTIRSSRDNQEANEEANTPLNKKSLESALHDPIELPNSAETPAGPRKMCLADRNDNLVAT
APVVSHIPFQGHAAGVAKVDPSAAASAHFVNPQNGNDDCNNFMSDFTPILPHENAFFTGT
QQGAFGFDGNGIMNHPDALDAFLNQTLVDTDEHSSTTSKVQYDSDIPTEFANHWNMQDEH
QDWWEKLDFEPYEPTLLPYDTTDLDVLSVDSGADSFNDLFNVTGITLRPQQLDSTVQPDC
VFPDQGTALRRLKLQVVECGESITKDESEDEVSCVESPNYFDESVEFAAEKGVASYGDGA
DSTGIVIRSRYPAPSSSSESSFTQQGTAMRRLRLQLGLNEGTCPSSGDSSSCIVDESESQ
QKAEIEEDASTNLAGSVDNLPGNSHDDEQKDIPEHDAEMSVSGVKSVLRLRKTSAESLKD
VKQEDCLEPDGRAPMQRVGFQSSIIWLVLSVAVLLLLYCGVWMSMICILVRCFAHMGSWH
QPDV*

KSLIRSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSKGDKRKQHTIGMK
KTLVFHRGRAPKGERTGWIMHEYRTTEPEFESGEQGGYVLYRLFRKQEEKTERSSPEEVD
RSGYSPTPSRSSPDNLEANEEANTPLNKESPESALHESPIELPKSVETNGGSMTRWLADR
NDNLMVTAPDVSHIPFHGHAAGVAKVDPSVGASGHLVNPHNGNDDYNKFVSDFTPILPLE
NAFFTDIQQGAFGFDGIMNPLDPLDAFLNQTLVDPDEHSSTTSKVQYDSDIPTEFENHWN
MKVEPQDDQCWWANIGFEPDEPNPLLPCDTTDQDILSVDSGADSFNELFNSMEETGIIVR
PQQLDSTVQPNHVFASQGNAARRLRLQVESREIITKDESEDEVSCVLTPDCLNDSVEEST
AEKDVASDGDEAESTGIVIRSHHPAPRSSSESSFTQQGTAMQRLRLQSGLNKGQRPSTDD
SSSCIIDEPGSQHKAEKAEIEEDASTNLAGSADDLPGNIHDDEQKNIPEHGAEMTSPEAK
SVLRLRKTSEEGNKDVKQESCLEPHVRAPMQKGGFQSYIIWLVLPVALLLLLCVGTYGWN
FRFLNPVTDGLLICWRVRIRLDMPQHGLRGYKD*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):1995Length 2 (bp):1902Length divergence:-0.024
MFE 1 (kcal):-692.18MFE 2 (kcal):-634.06MFE divergence-0.044