Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G003720-GRMZM2G009888
Species:maize
Duplication type:WGD
Function (paralog1):acyl-CoA thioesterase 13
Function (paralog2):LOC100286193 (si605090c10), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.13240675151159
Log2 mRNA fold difference:1.0586324926145
Log2 TE fold difference:-1.2121158144892
Sequences
Protein sequence

MGPEAVRKSLEPTATAEEITGSTPARLHFYDPFVLSGVRIEAAEHGRLLCSFVVTPRLAS
PVGYLRSGVTATLADQLGSAVFFCSGIPSSGVSIEISVSFVDSAAVGEEIEVEGKLLRAG
KSVGVVSVDFRKKKTGKLMAQARHTKYLVASSKL*

MDPEAVRKSLEPTANCRKKSPAPPLRGSTSTTPFVLSGVSIEAAEHGRLLCSFVVTPRLA
SPAGYLRSGVTATLADQLGSAVFFCSGLPSSGVSLEISVSFVDAAAVGEEIEVEGKLLRA
GKSVGVVSVDFRKKKTGKLMAQARHTKYLVASSRL*

Other information
Ka divergence:0.516599KaKs divergence:0.167956
GC content 1 (%):60GC content 2 (%):60GC content divergence:0
Length 1 (bp):465Length 2 (bp):468Length divergence:0.003
MFE 1 (kcal):-172.89MFE 2 (kcal):-187.8MFE divergence0.041