Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G004160-GRMZM2G177934
Species:maize
Duplication type:WGD
Function (paralog1):chemocyanin
Function (paralog2):chemocyanin

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.060890768191558
Log2 mRNA fold difference:-0.87921995413545
Log2 TE fold difference:0.45045867209714
Sequences
Protein sequence

MAAQGSGSARGSGAAAALALVLLCVLLHGELAESAVYTVGDRGGWSFNTANWPKGKRFRA
GDVLAFRYNAKAHNVVPVSAAGYKSCSAPKGVRALTTGNDRVTLKRGANYFICSFPGHCQ
AGMKIAVTAA*

MAQVRGSARGTGSGSSAAALALVLLCALLRGEFAESAVYTVGDRGGWSFNTASWPNGKRF
RAGDVLVFRYDARAHNVVPVSAAGYSSCSAPEGARALATGNDRVTLRRGANYFICSFPGH
CQAGMKVAVTAA*

Other information
Ka divergence:0.362808KaKs divergence:0.448922
GC content 1 (%):69GC content 2 (%):71GC content divergence:0.014
Length 1 (bp):393Length 2 (bp):399Length divergence:0.008
MFE 1 (kcal):-195.2MFE 2 (kcal):-208.8MFE divergence0.034