Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G004259-GRMZM2G049398
Species:maize
Duplication type:WGD
Function (paralog1):mitochondrial ribosomal protein L43
Function (paralog2):hypothetical protein LOC100191814

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5508506722184
Log2 mRNA fold difference:-3.0369445401492
Log2 TE fold difference:1.6743186309643
Sequences
Protein sequence

MALRGVWQLQKLVVNYCDWGGSSRGIRAFMEAHLPAFKEKNPHLEVVTELVRGQHPNLKG
IYKNHNERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM*

MALRGVWQLQKLVVNYCDWGGSSRGIRAFMEAHLPAFKEKIPHLEVVTELVRGQHPNLKG
IYKNHNERVVCVRNLPPEEILLQATRLRNSLGRKVVKLRTRHVTKRPSVQGTWTTELKM*

Other information
Ka divergence:1KaKs divergence:0.994269
GC content 1 (%):53GC content 2 (%):54GC content divergence:0.009
Length 1 (bp):360Length 2 (bp):360Length divergence:0
MFE 1 (kcal):-118.54MFE 2 (kcal):-125.4MFE divergence0.028