Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G004422-GRMZM5G863344
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274167
Function (paralog2):hypothetical protein LOC100216754

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.12822249099961
Log2 mRNA fold difference:-0.93927276240968
Log2 TE fold difference:1.2032244486415
Sequences
Protein sequence

MTSASELFTARRAARGARLSDLDLDPHADALRDQHGLGARHRRRGCRPRRQLDAAGDVRQ
HLHTGAPPPRRRGSYTDQILSYIDNNNLGVGDSAARRNRLDRLMFRTNERLPGAVLQAQA
RVLERLRGISLGSSVSRPSISLDEFSASDVFRIIDFRNREARHEENRHHSSSFHPSSESD
EERPTVGSTHSNRSTGLTKAAFLRLQVEIFEASKDDSREASPECSICLDGFYDGDELIRL
RCGHRFHSTCLEPWARKCADCPYCRTNIRSRS*

MTSASELFIARRAARGARLSDPDPDPDPHPVALRDQHGLGGRRQRRGCRPRRQLDAAGDV
RQHLHTGAPPPRRRGSYTDQILSYIDNNNFGDSASRRNRLDRLMFRTNERLPGAVLQAQA
RVLERLRGISLGSSASRPSISLDEFSANDVFRIIDFRNRETWHEANRPHSSSFHLGSESD
EERPNVSSVNSNRSTGLSKAAFLRLQIEIFEASKDDNREASPECSICLDGFYDGDELIRL
HCGHRFHSTCLEPWVRKCSDCPYCRTNIRSQS*

Other information
Ka divergence:0.0156575KaKs divergence:0.130661
GC content 1 (%):58GC content 2 (%):57GC content divergence:-0.009
Length 1 (bp):819Length 2 (bp):819Length divergence:0
MFE 1 (kcal):-325.3MFE 2 (kcal):-293.95MFE divergence-0.051