Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G004475-GRMZM2G123188
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.41374114057052
Log2 mRNA fold difference:0.13165786959516
Log2 TE fold difference:0
Sequences
Protein sequence

MATAAAQSHPASMDARRWDESSYRRGILRARDLSSRTLFRAVFFDHSDDPDTDILLAAAS
SDGSLASFSLSSCISACSATSQVETAATLVDPVCIVQAHSGPAYDVRFYPDQQQPLLFSC
GDDGRIKGWRWHEMQSCLVPLSLQGDHLEPALDLVNPQHEGPWGARSPVPENNAIAINKQ
DGSILAAAGDACAYCWDVETSKCKITFKGHADYLHSIAVRESNRQVVTGSEDGTARIWDC
RSGKCTRVIQPGKSKAFESSWVSCVAIDPSESWLACGTSSGISVWSLLSNECIFNLDCHA
PVQDLLFDKNHILAVGAEPLLSRLTINGTVLSQVKCAPQSAFSVSIHSTGVCAYLAALLI
SWLCSPLF

ISFGSLQILAVGAEPVLSRLTINGTVLSQIKCAPQCAFSVSIHSSGIAAVAGYGGLVDVI
SEVGSRHLCTFGSRGKDH

www.000webhost.com

Other information
Ka divergence:-0.197695KaKs divergence:0.0504715
GC content 1 (%):54GC content 2 (%):48GC content divergence:-0.059
Length 1 (bp):1104Length 2 (bp):234Length divergence:-0.65
MFE 1 (kcal):-404.45MFE 2 (kcal):-63.8MFE divergence-0.727