Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G004548-GRMZM2G091044
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100278779

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.8132815787142
Log2 mRNA fold difference:-1.2067421396267
Log2 TE fold difference:-0.63038537231756
Sequences
Protein sequence

MAIDHAARLGLTSRGATGGGGCGDDVDAENRRWPPWLKPLLCTSFFVQCRIHADAHKSEC
NMYCLDCMDGALCSLCLARHRDHHSIQIRRSSYHDVIRVSEIHKVLDIAGVQTYIINSAR
VVFLNERPQPRPGKGVTNTCEVCERSLLDCFRFCSLGCKIVGTARGYRPKKKHGGGGGGG
NKRKRAALKDVRSDSEESCTSTSGASSDKSSVVQSFSPSTPPPASASYRRPGNKRRKGVP
HRSPFGSLIVEF*

MAIDHATPLGLKRRGAMGGGGECDDGSDTRRWPPWLRPLLSASFFVQCRVHADAHKSECN
MYCLDCMGGALCALCLAARHRDHHSIQIRRSSYHDVIRVSEIQKVLDIAGVQTYIINSAR
VVFLNERPQPRPGKGVTNTCEVCERSLLDCFRFCSLGCKIVGTARGYRPGKKKHGGGGGN
KKRASPAPALKDVRSDSEDSCTSTSGASSDKSSVVQSSPPPPTSASHRPPGNKRRKGIPH
RSPLGSLIVEL*

Other information
Ka divergence:0.219816KaKs divergence:0.379525
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):759Length 2 (bp):756Length divergence:-0.002
MFE 1 (kcal):-361.74MFE 2 (kcal):-358.07MFE divergence-0.005