Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G004694-GRMZM2G302604
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100381931

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.74463738215218
Log2 mRNA fold difference:1.4811769426816
Log2 TE fold difference:-0.7533811789424
Sequences
Protein sequence

MASAPLPAAIEPGKKGNVKFAFACAILASMTSILLGYDIGVMSGASLYIKKDLKISDVKL
EILMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYWMLMFGRFV
AGIGVGYALMIAPVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLRLGWR
VMLGIGAAPSVVLALMVLGMPESPRWLVMKGRLADAKVVLGKTSDTPEEAAERLADIKAA
AGIPQELDGDVVAVPKKRDSEEARVWKELILSPTPAMRRILLSGIGIHFFQQASGIDAVV
LYSPRVFKAAGITSDNQLLGTTCAVGVTKTLFILVATFLLDRVGRRPLLLSSVGGMIFSL
VGLAAGLTVIGHYQDEKIPWAIGVAIASTMAYVAFFSIGLGPITWVYSSEVFPLHVRAMG
CALGVASNRLTSGVISMTFISLSKAITIGGAFFLYAGVAVLAWVFFFTFLPETRGRTLEA
MSKLFGATDDELKPQDGATKDKQKLELAATGTN*

MASADLAEAMEPGKKSNVKYASVCAIMASMACVILGYDIGVMSGAAIYIKKDLKITDVQL
EILIGIISLYSLIGSFAGARTSDRIGRRLTVVFAAVIFFVGALLMGFSVNYGMLMVGRFV
AGVGVGYGGMIAPVYTAEISPAASRGFLTSFPEVFINLGILLGYLSNYAFAGLPLHLGWR
VMLGIGAAPSALLALLVFCMPESPRWLVMKGRLADARAVLEKTSASPEEAAERLADIKVA
AGIPKDLDGDVVTVPKERNSGEMQVWKDLILSPTPAIRRILLSAVGLHFFQQASGCDSVV
LYSPSVFRSAGITGDNKLLGVTCAVGVTKTLFILVATFLLDRVGRRPLLLTSTGGMVISL
ISLGTALTVVGHHPDAKIPSVVALCIASTLAFVAFFSIGLGPITGVYNSEIFPLQLRALG
FAVGVACNRVTSAVISMTFLSLSKAITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTLEE
MGKLFGMPDTDMAEADDTAAKEKVVEMSTK*

Other information
Ka divergence:0.669628KaKs divergence:0.227401
GC content 1 (%):66GC content 2 (%):63GC content divergence:-0.023
Length 1 (bp):1542Length 2 (bp):1533Length divergence:-0.003
MFE 1 (kcal):-738.44MFE 2 (kcal):-684.11MFE divergence-0.038