Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G004696-GRMZM2G130953
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193444
Function (paralog2):hypothetical protein LOC100194253

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.5251246845202
Log2 mRNA fold difference:-1.1276014146437
Log2 TE fold difference:-1.3733328368853
Sequences
Protein sequence

MSVETERSSTESSGASGLDFEDTALTLTLRLPGSAPSAAAAAAASLSLSSSSSSAFPDPD
RKRASSDADPGRSSPLAASSDAAPAPKARVVGWPPVRSYRKNALADAAGSSKAAKFVKVA
VDGAPYLRKVDLQAYAGYDQLLRALQDKFFSHFTIRKFADDERKLVDAVNGTEYVPTYED
KDGDWMLVGDVPWKMFVETCQRLRLMKGSEAVNLAPRAAR*

MSVDTERSSTESSAASGLGYEDTALALTLRLPGSDPGRSSPLAAPSDAAPSPKTRVVGWP
PVRSYRKNALADSSKANRSASFVKVAVDGAAYLRKVDLQAYGGYDQLLRALQDKFFSHFT
ISQCFVHRPALGLVFRSALLCLIERYVPAGCARREVRRRREEAGGRGERDGVRAHVRGQG
WRLDARRRRPLEDVRGDLPAPSPDERFRGR*

Other information
Ka divergence:0.84742KaKs divergence:0.0697509
GC content 1 (%):69GC content 2 (%):67GC content divergence:-0.015
Length 1 (bp):663Length 2 (bp):633Length divergence:-0.023
MFE 1 (kcal):-289.42MFE 2 (kcal):-277.9MFE divergence-0.02