Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G004732-GRMZM2G460571
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.3844872792661
Log2 mRNA fold difference:-0.17223556183037
Log2 TE fold difference:0.62946876334505
Sequences
Protein sequence

MADHQMIHPPAAATTGSKTHGHAGDWWTTTVSCSPDQLPDGFGGAGWSSAAATTAAEGNR
SRSGNAAASSESPGSIHSLPTAGSSITFQESAVGAAVGDQGVVAMPPHPVASGHAGSSWN
QPSYYFDQQAHHLSLRSPSSNNTSTMVPDSHHDDPNHQFLSNLGLELLSSSPTSSSGGFR
TSSSLLRSLTEPSAVATGFQQYQQQAVNQAPPESIRDDALQFVNSTPFWSASAVFASAAE
GATSRLPASAAGPPSAQSMPANFAVKSALLEGARGDSSSITANKTSTDPTPRLKKSRTGT
PSPLPATFKVRKEKLGDRITALQQLVSPFGKTDTASVLHETIEYIKFLHDQVGSLSVPYL
KKNRQQEVPPHKVLWDGGGEAAGANGELTGRGLCLVPISSTFAVASETTTTPPLDFWTPF
GGPAFR*

MADHQEMIHPPAAAATTGSTTTHGDWWTTAVSWSPDQQLPAGFGGWASSAAATAGGNRSR
SGNNAAASSESPGSKSNHSLTTDQGVVSVPPHPPPAASAHAASGSWNEPSYYFVMVQGAH
DPNQQFLSNLGFELLSSPTSSSGGFRSSSPSLLRSLTEPSAAANTTPPGLLQQYQQQQQQ
TMDQAPAGSIREALQLTTNRTPFWNPCAEGAASLLGTARPPSSGLASFPSKGAIEGAGGS
SNIIAKRTNTVPTPSLKKPRTGTPSPLPTFKVRKEKLGDRITALQQLVSPFGKVSDPRS*

Other information
Ka divergence:0.257266KaKs divergence:0.0133428
GC content 1 (%):60GC content 2 (%):62GC content divergence:0.016
Length 1 (bp):1281Length 2 (bp):900Length divergence:-0.175
MFE 1 (kcal):-534.34MFE 2 (kcal):-367.6MFE divergence-0.185