Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G004768-GRMZM2G102502
Species:maize
Duplication type:WGD
Function (paralog1):peroxisomal biogenesis factor 19
Function (paralog2):peroxisomal biogenesis factor 19

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.33889518324914
Log2 mRNA fold difference:0.098451053282775
Log2 TE fold difference:-0.28472407009677
Sequences
Protein sequence

MASSNSAAPAPADGGDDLDQLLDSALDDFTNLDLSASAAPKSSGEASGSGSGGKGPVKGL
GLGLPDPKAPKRRAGKQPPPRGACAKEALEELTRETREAVRGLETATGSVPSLDDDAMME
EFVKQFQEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEDNKDKISKEEYG
RYNNQLELMVKLIEVYENDPENMTRIFDIMQNMQECGQPPSDLVQDIVPDLDLSKLGQLS
PEMLESAPNCCVM*

MASNSAAPAAADGGDDLDQLLDSALDDFTSLDLSASAAPKSAGEASGSGSGGKGPVKGLG
LGLPDPKVPKRRAGKQPPPRGACAKEALEELTRETREAVRELETATGGVPSLDDDAMMEE
FVKQFEEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEDNKNKISKEEYER
YNNQLELMVKLIEVYENDPENMTKIFDIMQNMQECGQPPSDLVQDTVPDLDLSKLGQLSP
EMLESAPNCCVM*

Other information
Ka divergence:0.0249527KaKs divergence:0.11131
GC content 1 (%):55GC content 2 (%):55GC content divergence:0
Length 1 (bp):762Length 2 (bp):759Length divergence:-0.002
MFE 1 (kcal):-295.02MFE 2 (kcal):-302.24MFE divergence0.012