Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G005040-GRMZM2G327234
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.4670076792074
Log2 mRNA fold difference:1.7608541680372
Log2 TE fold difference:-0.29282374128423
Sequences
Protein sequence

MSSMASLSESELTNRGSMWELDQNLDQPMDEEAGRLKNMYREKKFSSALLLRLAFQSLGV
VFGDLGTSPLYVFYNIFPRGIGEGEDEDVIGALSLIIYTLTFIPLLKYVFVVLRANDNGQ
GGTFALYSLLCRHAKINTIPNQHRTDEELTTYSRQTYEENSVAAKIKRWIESHAYKRNIL
LVLVLIGTCTAIGDGILTPAISVLSASGGIRVQNQNMSTDVVVLVAVVILIGLFSMQHYG
TDKVGLLFAPIVLLWFILIGSVGAINIHKYNNSVLRAYNPISIYRFFQRRRNYDIWTSLG
GIMLSITGTEALFADLCHFPVLAIQIAFTLIVFPCLLLAYTGQAAYIISNKTHVADAFYR
SIPDAIYWPAFVIATAAAIVASQATISATYSIIKQALALGCFPRVKIVHTSKKFLGQIYM
PDINWILLVLCIAVTAGFKNQSQIGNAYGTAVVIVMLVTTFLMVPIMLLVWKSHWILVVT
FIVLSLMVEVPYFVACILKIDQGGWVPLVVATAFFLIMYVWHFCTVKRYEFEMHSKVSMA
WILGLGPSLGLVRVPGIGFVYTELASGVPHIFSHFITNLPAIHSVVVFVCVKYLPVYTVP
TEERFLVRRIGPRSFHMFRCVARYGYKDLHKRDEDFEKVLFDCVLFFVRLESMMEGYSDS
DEFSVPEQAPGIGRAAFLSVGERTCATVCSSGDLSFSSQDSVVPAAAQSSRAPTGLRVLH
YSASASAAGQGSSGGTVGDELEFLNRCKDAGVVHILGNTIVRARRDSGVVKKLAVDYMYA
FMRRVCRENSVIFNVPHESLLNVGQIFYI*

MASLSESELTNRGTMWELDQNLDQPMDEEAGRLKNMYREKKFSSALLLRLAFQSLGVVFG
DLGTSPLYVFYNIFPRGIGEGEDEDVIGALSLIIYTLTLIPLLKYVFVVLRANDNGQGGT
FALYSLLCRHAKINTIPNQHRTDEELTTYSRQTYEENSVAAKIKRWIESHAYKRNILLIL
VLIGTCTAIGDGILTPAISVLSASGGIKVQNQNMSTDVVVLVAVVILIGLFSMQHYGTDK
VGWLFAPIVLLWFILIGSVGAINIHKYDSSVLKAYNPMYIYRFFRRRKNSDVWTSLGGIM
LSITGTEALFADLCHFPVLAIQIAFTLIVFPCLLLAYTGQAAYIISNKTHVADAFYRSIP
AAIYWPAFIIATAAAIVASQATISATYSIIKQALALGCFPRVKIVHTSKKFLGQIYIPDI
NWILLVLCIAVTAGFKNQSQIGNAYGKVSSEN*

Other information
Ka divergence:0.063235KaKs divergence:-0.160653
GC content 1 (%):52GC content 2 (%):46GC content divergence:-0.061
Length 1 (bp):2430Length 2 (bp):1359Length divergence:-0.283
MFE 1 (kcal):-904.61MFE 2 (kcal):-420.16MFE divergence-0.366