Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G005080-GRMZM2G120047
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193140
Function (paralog2):hypothetical protein LOC100191947

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.88467693606895
Log2 mRNA fold difference:-0.083670903295784
Log2 TE fold difference:-0.80000245494266
Sequences
Protein sequence

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSALGILAADGVVLVGEKKVTSKLLQTSR
SAEKMYKIDSHLACAVAGIMSDANILINTARLHAQRYALSYQEPIPVEQLVQSLCDTKQG
YTQFGGLRPFGVSFLFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANSQAAQSMLKQDYK
DGLTREEAVALALKVLSKTMDSTSLTAEKLELAEVFLQPGSGEVQYQVCSPEALGKLLAK
SGLTQPTPEA*

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSALGILAADGVVLVGEKKVTSKLLQTSR
SAEKMYKIDSHLACAVAGIMSDANILINTARLHAQRYALSYQEPIPVEQLVQSLCDTKQG
YTQFGGLRPFGVSFLFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANSQAAQSMLKQDYK
DALTREEAVGLALKVLSKTMDSTSLTAEKLELAEVFLQPDTGEVQYQVCSPEALGKLLAN
SGLTQPTPEA*

Other information
Ka divergence:1KaKs divergence:-0.994652
GC content 1 (%):64GC content 2 (%):63GC content divergence:-0.008
Length 1 (bp):753Length 2 (bp):753Length divergence:0
MFE 1 (kcal):-326.5MFE 2 (kcal):-328.8MFE divergence0.004