Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G005339-GRMZM2G075408
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193354
Function (paralog2):LOC100283133

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0360386778119
Log2 mRNA fold difference:-0.96962099329168
Log2 TE fold difference:-0.098148313303409
Sequences
Protein sequence

MALAAIYNLFIINKSGGLIYYKDYGSAGRMDTNDSLRLASLWHSMHAISQQLSPTTGCTG
IDLLQAHNFDLHCFQSLTGTKFFVVCETGAPNMEMLLKAIYELYTDFVLKNPFYEMEMPI
RCELFDHNLAQVIQKDRVALLGR*

MALAAIYNLFIINKSGGLIYYKDYGSAGRMDTNDSLRLASLWHSMHAISQQLSPTPGCTG
IDLLQAHNFDLHCFQSLTGTKFFVVCETGAPNMEMLLKVIYELYTDFVLKNPFYEMEMPI
RCELFDHNLAQMIQKDRVALLGR*

Other information
Ka divergence:-1KaKs divergence:-0.998195
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):432Length 2 (bp):432Length divergence:0
MFE 1 (kcal):-117.9MFE 2 (kcal):-124.5MFE divergence0.027