Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G005384-GRMZM2G046353
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276078
Function (paralog2):hypothetical protein LOC100278926

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.13405695708014
Log2 mRNA fold difference:0.20313167763127
Log2 TE fold difference:-1.1612883376209
Sequences
Protein sequence

MAVSSPRRALIAAVSLCFLLGAASSVRTATFSPSQQQNLAEDKSRLGSTPPSCRNRCSAC
NPCMPVQVTTVPGLGRGARATDVDDDTVAVAAGFSRYSNYKPLGWKCRCDGRLYDP*

MAVISPRRALVAAVSLCLLLGAATSIRTATFSPSQVRDHRHPTRRRFRVSLLMTPDPVPR
KCVSDSSETDSALRFCEAQENLAEDKSRLGSTPPICRNRCSACNPCMPVQVTTAPAGLGR
AARVTDADADAVAGFSRYSDYKPLGWKCGCDGRLYDP*

www.000webhost.com

Other information
Ka divergence:0.133052KaKs divergence:-0.321081
GC content 1 (%):71GC content 2 (%):68GC content divergence:-0.022
Length 1 (bp):351Length 2 (bp):474Length divergence:0.149
MFE 1 (kcal):-168.8MFE 2 (kcal):-208.72MFE divergence0.106