Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G006047-GRMZM2G130454
Species:maize
Duplication type:WGD
Function (paralog1):LOC100286065
Function (paralog2):hypothetical protein LOC100192116

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0751300216689
Log2 mRNA fold difference:-1.271304062201
Log2 TE fold difference:0.20944910718113
Sequences
Protein sequence

MAAAAAARAGASGVAWLLAAAVAAALVASASAQSGCTTTLISLYPCLNYISGNVSAPPSS
CCSQLASVVQTNPQCLCAALSGDSSSLGGVTVDKTRALQLPQACNVKTPPASKCNSAGGG
SAPGAATPATPSAGVPATAGKATNNCAHQSSYGSAVHGFSLTRHEPMQEPALDRRRRRRP
RS*

MAAGAGAGASAPVAWLLAAAVAAAALAASASAQSGCTTTLISLYPCLNYISGNVSTPPPS
CCSQLASVVQTSPQCLCAALSSDSSSLGGVTIDRTRALQAAAAPGVQRQDPAGEQVQLCW
WRQRSGRRDAGRAVVRRASDRSRRNWQWIEGDADGAVPNVRRRVSPGRGEPGASIRGCHR
LCHIGHVTDLARLSLLPTAFGDSDVTRSGFNLA*

Other information
Ka divergence:0.500475KaKs divergence:0.0258109
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):549Length 2 (bp):642Length divergence:0.078
MFE 1 (kcal):-255.4MFE 2 (kcal):-337.4MFE divergence0.138