Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G006071-GRMZM2G042343
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100192067

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.31515174522937
Log2 mRNA fold difference:-0.53228688956965
Log2 TE fold difference:0.81869123980717
Sequences
Protein sequence

MAAAGGEEEAGESRKLFVGGIPAGAQEPELRAHFSRFGEVRSVIVMRDRETGHGRGFGFV
EFEEEAAAGTALGDGEKLKHFLCGRMVDVKRARTRAPRNQGEQHSQPQQAEQGRGQGNQD
NQSPAGNGTADCGNSVSYDSKKVFIGGLRDNITEKEFRAYFETFGTVTDVVVIYDSATSR
SRGFGFVTFDSEEAVGKVMRQSFHDLNGTKVEAKIAIPKDEQYYRNRGGHGARPFGGRDP
AAPGYGGFMYQTYNARSGPYNGYMPQPAPTHPYFPAPYFAAGGYPYGSGYPGQGVMPNIP
GMGPRRGPPAYGTYPQMYPVYNIIHRAGYGGPATSFQHEINGGGDYKKDQTNVDMQQVDN
TASVATKLENMKLG*

MEDAAESRKLFVGGIPAGAQEADLRAHFARFGEVRSVVVMRDRETGHGRGFGFVEFEDKA
AAAAAAALGDADRPRHFLCGRAVDVKRARARAPRNQREQHSQPHQVEQGLDQGNQDNQYP
MGNGTADSGDNVNYGSKKVFVGGLQDDTTEEEFRAYFETFGTVTDVAVIYDSATNRSRGF
GFVTFDSEEAVGKVMRQSFHDLNGTKVEAKIAIPKDEQYYRNRGRGARSSGGRVPAGYEG
SMYQPPYNAGYGSYNGYMPQPVHVQPYFPAPYFPVAGYPYGSGYPSQVVMANAPDMMSRW
VPPAYGNYPQMYPWYILYRAGYGGPATSFQHGINGGGADNKKDQTNVDMQQADNTSSVTT
MLEHMKLGSQ*

Other information
Ka divergence:0.148023KaKs divergence:0.113015
GC content 1 (%):57GC content 2 (%):57GC content divergence:0
Length 1 (bp):1125Length 2 (bp):1113Length divergence:-0.005
MFE 1 (kcal):-466.87MFE 2 (kcal):-446.5MFE divergence-0.022