Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G006117-GRMZM2G039811
Species:maize
Duplication type:WGD
Function (paralog1):transmembrane 9 superfamily protein member 4
Function (paralog2):hypothetical protein LOC100193342

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.72685477781548
Log2 mRNA fold difference:-1.1982016223677
Log2 TE fold difference:0.47366237023276
Sequences
Protein sequence

MRTPAMLRWAAALAVLLAVAAPAAGFYLPGVAPSDFAKGDPLPVKVNKLTSIKTQLPYTY
YSLPFCKPDTIVDSAENLGEVLRGDRIENSPYVFKMGEPKMCQIVCRAPITEKEAKELKE
KIEDEYRVNMILDNLPLVVPVTRQDKNSIAYQGGYHVGAKGLYSGTKDEKYFIHNHLSFT
VKYHKDDNLEHSRIVGFEVNPHSVKHQVDDKWNGVDTRLSTCDPHASKFVINSDSPQEVE
VGKEIIFTYDVRFEESEIKWASRWDTYLLMTDDQIHWFSIVNSLMIVLFLSGMVAMIMLR
TLYRDISRYNQLETQEEAQEETGWKLVHGDVFRPPTYSDLLCVYVGTGVQFFGMLVVTMI
FAVLGFLSPSNRGGLMTAMLLVWVLMGLLAGYSSSRLYKMFKGSEWKKITLQTAFLFPGV
AFVIFFILNALIWGEKSSGAVPFTTMFALVLLWFGISVPLVFVGSYLGFKKPAMEPPVKT
NKIPRQIPEQAWYMNPLFTILIGGVLPFGAVFIELFFILTSIWLHQFYYIFGFLFLVFVI
LIITCAEITIVLCYFQLCSEDYMWWWRSYLTSGSSALYLFLYAGFYFFTKLQITKLVSGI
LYFGYMLLASYAFFVLTGTIGFCACFWFTRLIYSSVKID*

MRTPAMLRWAAALAVLLAVAAPAAGFYLPGVAPTDFAKGGPLPVKVNKLTSIKTQLPYTY
YSLPFCKPDAIVDSAENLGEVLRGDRIENSPYVFKMREPKMCQIVCKAKITEKEAKELKE
KIEEEYRVNMILDNLPLVVPVNRQDKNSIAYQGGYHVGLKGVYSGTKNEKYFIHNHLSFT
VKYHRDDNSELSRIVGFEVNPLRYFDTFFASVKHQIDDKWNGVDTRLSTCDPHASKFVIN
SDSPQEVEADKEIIFTYDVHFEESEIKWASRWDTYLLMTDDQIHWFSIVNSLMIVLFLSG
MVAMIMLRTLYRDISRYNQLETQEEAQEETGWKLVHGDVFRPPTHSDLLCVCVGTGVQFF
GMLLVTMIFAVLGFLSPSNRGGLMTAMLLVWVLMGLLAGYSSSRLYKMLKGSEWKKITLQ
TAFLFPGVAFVIFFILNALIWGEKSSGAVPFTTMFALVLLWFGISVPLVFVGSYLGFKKP
AMEPPVKTSKIPRQIPEQAWYMNPLFTILIGGVLPFGAVFIELFFILTSIWLHQFYYIFG
FLFLVFVILVITCAEIAVVLCYFQLCSEDYMWWWRSYLTSGSSALYLFLYAAFYFFTKLQ
ITKLVSGILYFGYMFLASYAFFVLTGTIGFCACFWFTRLIYSSVKID*

www.000webhost.com

Other information
Ka divergence:0.303234KaKs divergence:0.287812
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1920Length 2 (bp):1944Length divergence:0.006
MFE 1 (kcal):-649.42MFE 2 (kcal):-652.21MFE divergence0.002