Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G006704-GRMZM2G122481
Species:maize
Duplication type:WGD
Function (paralog1):Cytochrome c oxidase polypeptide VcPutative uncharacterized protein ;
Function (paralog2):Cytochrome c oxidase polypeptide VcPutative uncharacterized protein ;

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.9013888981516
Log2 mRNA fold difference:-4.6333601780943
Log2 TE fold difference:1.7365286374688
Sequences
Protein sequence

MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVV
VEE*

MAGGRVAHATLKGPSVVKEIFIGLTLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVV
VEE*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):55GC content 2 (%):57GC content divergence:0.018
Length 1 (bp):192Length 2 (bp):192Length divergence:0
MFE 1 (kcal):-61MFE 2 (kcal):-70.4MFE divergence0.072