Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G006736-GRMZM2G543629
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):RNA polymerase sigma factor 2 Fragment

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.9746108214742
Log2 mRNA fold difference:0.99383902152994
Log2 TE fold difference:-0.017424563144899
Sequences
Protein sequence

MTATPAVIGLSAGNRLLATSFGSAELASPDAYPSRQFAAAAPKLTVVAHRASASASSPAN
IGGAGHARAHAIRALRNHSAPALAPPPPADPAPELDSKFEFESSLEAIVLLQRSMLEKQW
ELPFEDDISSTEDEDEDERSTVVVARSGVSARQRRMSGRRRGAVVGRKSVTVSPELMQSR
NRIYLRGTVSKDLLTHKQVVQLSRKIKDGIWLQHQRSKLKEKLGNEPSYKQLAQSLRIPA
PELRARMRESFLAREMLAMSNTRLVISIAQKYDNLGVELPDLIQGGLIGLLRGIEKFDAS
RGFRISTYVYWWIRQGVSRALADNSRSFRLPTYLHERLVAIRGAKYALEDQGIAPTVENI
AESLNISEKKVHNATEAVHKVISLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEER
YLKEEVNSLINSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQVGLVAMEKL
KHAARREHLDALLEEY*

MTATPAVIGLSAGHRLLATSFGSPDLASPDAHSSLQFAAAAPKLTVVAHRAPASSSSSSP
PNVGRGSSAAGHARARAIRALRNHSAPALATPPPPPLPADPTPDLDSEFESSLEAIVLLQ
RSMLEKQWELPFEDDIISTDDEQDDRVSKATVVAARSGVSARQRRMSGRRRGAGRKSVAI
SPELMQSRNRIYLRGTVSKDLLTHKQVIQLSRKIKDGIWLQHQRSKLKEKLGNEPSYKQL
AQSLRISAPELRARMRESFLAREMLTMSNIRLVISIAHKYDNLGVDLADLIQGGLIGLLR
GIEKFDASRGFRISTYVYWWIRQGVSRALADNSKTFRLPTYLHERLIAIRGAKYALEDQG
IAPTIENIAESLNISEKKVHNATEAVNKVLSLDQQAFPSLNGLPGDTLHSYIEDQNVAND
PWHGFEEMYLKEEVNNLINSNLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQV
GLVAMEKLKHAARRKHLDALLEDY*

Other information
Ka divergence:-0.103812KaKs divergence:0.239702
GC content 1 (%):60GC content 2 (%):57GC content divergence:-0.026
Length 1 (bp):1491Length 2 (bp):1515Length divergence:0.008
MFE 1 (kcal):-631.42MFE 2 (kcal):-593.03MFE divergence-0.031