Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G006973-GRMZM2G142345
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100280142 (LOC100280142), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0587575730325
Log2 mRNA fold difference:0.81099315736671
Log2 TE fold difference:-1.8626395382516
Sequences
Protein sequence

MGNALGCAGLGERLAAGARDGDAAEVRRLLDANPGLARCAAFGSLSSPLHLAAAKGHHEI
AALLLENGADVNGRNIYGQTALMQACRFGHWEVVQTLLLFRCNVSKADSLSGRTALHVAA
AGGHVRCARLLLAGAGSGRSKLVNRAASGGGGGVTALHLAALHGHADCVHLLVDERADVA
ARTLPCAAPPMASVGAGSAPLHYAAAGGEVKCCQILVSRGADRAAVNCNGQVAPGGRGQD
VGVPLAGARPVAQVSAAHPQVPALRIPLVAARQRHHPREVRTHRRFNKNHHEHFLNMDGW
IDDTCRDCGLALNMSSLPMDTMDGGADDGDACAVCLERPCNVAAEVCGHELCVKCALDLC
SVIRSYDAPGIAGTIPCPLCRSGIASFRRRAAAAEAEPGANAGDRQASSSPHKKRSTESD
QDGLPLVCAPPAVMSS*

MGNALGCAGLGERLAASARNGDAAEVRRLLEENPGLARCAAVGSSLNSPLHLAAAKGHHE
IAALLLENGAEVNARNLSGETALMQACRFGHWEVVQTLLVFGCNVSKVDSLSGQTALHLA
AAGGHATCVRLLLAGAGAGRNKLVNRAASGGVTALHLAALHGHADCVHLLVDERADVAAP
TLPCTAAPMAAIGAGSAPLHYAAAGGEVRCCQILVARGADRAAANCNGWIPLDVARTWGC
QWLEHVLSPESHLRIPRFPPSAYLSSPLASALALARDCRLLLNTAQLDSGGADACAVCLE
RPCDVAAEVCGHELCAKCALDLCSVVKSYDVPGIAGTIPCPLCRSAIASFRMRAAADEPE
PDVNDAGGGRRGAGDRQAAPSSPEKKRSTDSEQDVVLPFYCAPLAVPS*

Other information
Ka divergence:-0.240588KaKs divergence:0.337511
GC content 1 (%):71GC content 2 (%):73GC content divergence:0.014
Length 1 (bp):1311Length 2 (bp):1227Length divergence:-0.033
MFE 1 (kcal):-701MFE 2 (kcal):-672.01MFE divergence-0.021