Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G007025-GRMZM2G037193
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.71506859695749
Log2 mRNA fold difference:0.47497841601708
Log2 TE fold difference:-1.1930084682247
Sequences
Protein sequence

MGVKQVLVRPRYGDEDVVDQSPPPPMSSSPCGRYVHHRVCRFDTLAGVAIKYGVEVADVK
RANGLTTDLQMFAHKTLRVPLHGRHAPSPPSSSPSHAAREWTKNAASLDPLLKLKPPRST
VSPSMSLLLQGCHGLTPAPKGDLNLTDECAQGHHRKAGSLSSTLLPRRAGQGLALRPKSG
GRADTNGIQQDLLAAWVPSYGDGLRAVKRSSSAPEFQDSDSVSLASAWLKSKWNLKPDYA
FTLALFDGISKPLLDSIPKPLLDNIPNSIVAWRNKAARD*

MGVKQVLVRPRYGDGDGDDDGGTSSSSSTGRCDEDVVDQSPPPMSSCGRYLLHRVCRFDT
LAGVAIKYGVEVADVKRANGLNADLQMFAHKTLRVPLHGSHQPAAAPPSLPSYSPRNHAD
RVAREWTTRRPPKNAASMDPFLKPPRSTVSPSMSLLQGYYGLPPTPQENLTYEGTEMATY
AQGHHRKARSLSSSEHGDGADDAEKPIRRRQKADSELTTGREDNGGCLLPRAGQGLALRP
KSGSRPDGNGSQLDLSATWVPSYGDGLHTVKKSSSTPEFQDSDSISIASEWLKSKWNLKP
DAFTLTLPPLPLLDSIPKPLLDNIPNSIAAWRNKAAKD*

Other information
Ka divergence:-0.247045KaKs divergence:-0.0691548
GC content 1 (%):63GC content 2 (%):62GC content divergence:-0.008
Length 1 (bp):840Length 2 (bp):1017Length divergence:0.095
MFE 1 (kcal):-356.99MFE 2 (kcal):-399.81MFE divergence0.057