Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G007055-GRMZM2G179329
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279315
Function (paralog2):hypothetical protein LOC100381622

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.32923056096053
Log2 mRNA fold difference:1.6321191029524
Log2 TE fold difference:-1.2635045155086
Sequences
Protein sequence

MRKLCPNLERDDALDTVLEVPIPEEMFSGGGGSRGSTRFGCTNVKAWMRSHAADRSGAGE
PCSMTRGELQLMLGVIGAPLIPLPVYHANQSPCSVLCEQLKADPIESSSAKYIVQQYIAA
SGGEWALNKVKSMYAMGKVRMTAAELNSSDADGHGGSTGNGHHRGGKKGSKGGGVAPDAV
APVARIPRSPAPAPPFAPGPRSAADREPVRGLGVHRRAEHRRRGLLRAQGGGGGVQPARA
QQQQRRDHPAHGVGLLQPAHGPAGAAGGLAPAADQVQRRRRRRERLLGDHHGVPPRRLPR
RRRRQHRPRRPHRRLARQVRRLPGRQHQDAHGGGVEHRGGGLQHLGPLHGLLPAAQRPQG
GQGEPGRRRRQGRRAPAAAEDTGGHRARRALAGGCRQHGRLGLARREVMTTRHVPYVRTY
VLAVLSEEHVFVRDTCVTIRSYMSQDL*

MRKVCPNLERDDALDTVLEVPIPEEMFSGGGGGGGGSCGFRFGCTSVKAWMRSHAADRCG
AGEPCSMSRGELQLMLGVIGAPLVPLPVAVCCRAEQSPCSVLCEQLKTGPIESSSAKYIV
QQYVAASGGERALDRVKSMYAMGKVRMTAAEQLNGSDAAGGHCGGATGKGNRGGRRKGRG
GEVGGFVLWQKRPELWCLELVVSGCKISAGSDGKVAWRQTPWHQSHASRGPPRPLRRSLQ
GLDPQLTASLFADSVCIGERSVDGEDCFVLKVEAEASSLRARNSGSVEIVRHTLWGYFSQ
RTGLLVQLEDSHLLQIRSGGGGGGGSIFWETTVESRLGDYRAVDGVNIAHAGRTAVSLVR
FGDCQQDGSSARTRMEETWDIEEVDFNIWGLSMDCFLPPSDLREGGKESQDVAVAVAKAD
ARPPPIRIPAVAVRVGPSQVAAVSMDDSDSLIARP*

Other information
Ka divergence:-0.812734KaKs divergence:0.989407
GC content 1 (%):67GC content 2 (%):71GC content divergence:0.029
Length 1 (bp):1344Length 2 (bp):1368Length divergence:0.009
MFE 1 (kcal):-677.4MFE 2 (kcal):-749.6MFE divergence0.051