Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G007188-GRMZM2G081622
Species:maize
Duplication type:WGD
Function (paralog1):ADP-ribosylation factor-like protein 8B
Function (paralog2):hypothetical protein LOC100191622

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.24971297313994
Log2 mRNA fold difference:0.61553829865884
Log2 TE fold difference:-0.42345590997582
Sequences
Protein sequence

MGFWEFFLNWLRSLFFKQEMELSLVGLQNAGKTSLVNSIATGGFSEDMIPTVGFNMRKVT
KGNVTIKLWDIGGQPRFRSMWERYCRAVSAIVYVVDAADRENMAIAKGELHDLLSKPSLT
GIPLLVIGNKIDKPEAFPKQTFTEIMGLKTITDREVACFMTSCKNSTNIDSVIDWLVKNS
KKKN*

MGFWEAFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNSIATGGFSEDMIPTVGFNMRKVT
KGNVTIKLWDLGGQPRFRSMWERYCRAVSAIVYVVDAADRENMAIAKGELHDLLSKPSLT
GIPLLVIGNKIDKPEAFPKQTFTELMGLKTITDREVACFMTSCKNSTNIDSVIEWLVKHS
KKKN*

Other information
Ka divergence:-0.446373KaKs divergence:-0.630153
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):555Length 2 (bp):555Length divergence:0
MFE 1 (kcal):-156.7MFE 2 (kcal):-166MFE divergence0.029