Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G007277-GRMZM2G115451
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280270
Function (paralog2):hypothetical protein LOC100272522

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.30729063357322
Log2 mRNA fold difference:0.53767313443528
Log2 TE fold difference:-0.17225843774032
Sequences
Protein sequence

MKRVSSHVSLASEAEINLDLSRLIIDKPRFTLERKRSFDEQSWSELSHRQNDGFDSVLQS
PAFPSGVFDSPFSVGTHFGGPHPLVNEAWEALRKSVVYFREQPVGTIAAVDHASEEVLNY
DQVFVRDFVPSALAFLMNNETDIVKNFLLKTLHLQSSEKMVDRFKLGAGAMPASFKVDRN
KNRNTETLVADFGESAIGRVAPVDSGFWWIILLRAYTKYTGDVSLSESPECQKCMRLILN
LCLSEGFDTFPTLLCTDGCSMIDRRMGIYGYPIEIQALFYMALRCALQMLKPEGEGKDFI
EKIGQRLHALTYHMRNYFWLDFHQLNNIYRYKTEEYSHTAVNKFNVIPDSIPDWVFGFMP
CRGGYFLGNVSPAMMDFRWFALGNCIAIVSSLATPEQSVAIMDLIEEKWDELVGEMPLKI
CYPALENHEWRIITGCDPKNTRWSYHNGGSWPVLLWLLTAACIKTGRPQMAKRAIELAES
RLLKDGWPEYYDGKLGRFVGKQARKFQTWSIAGYLVARMMLEDPSTLMMISMEEDRPVKP
TMRRSASWNA*

MKRVSSHVSLASEAEINLDLSRLVIDKPRFTLERKRSFDEQSWSELSHRQNDGFDSVLQS
PAFPSGGFDSPFSVGTHFGGPHPLVNEAWEALRKSVVYFREQPVGTIAAVDHASEEVLNY
DQVFVRDFVPSALAFLMNNETDIVKNFLLKTLHLQSSEKMVDRFKLGAGAMPASFKVDRN
KNRNTETLVADFGESAIGRVAPVDSGFWWIILLRAYTKYTGDVSLSESPECQKCMRLILN
LCLSEGFDTFPTLLCTDGCSMIDRRMGIYGYPIEIQALFYMALRCALQMLKPEGEGKDFI
EKIGQRLHALTYHMRNYFWLDFHQLNNIYRYKTEEYSHTAVNKFNVIPDSIPDWVFDFMP
CRGGYFLGNVSPAMMDFRWFALGNCIAIVSSLATPEQSVAIMDLIEEKWDELVGEMPLKI
CYPALENHEWRIITGCDPKNTRWSYHNGGSWPVLLWLLTAACIKTGRPQMAKRAIELAES
RLLKDGWPEYYDGKLGRFVGKQARKFQTWSIAGYLVARMMLEDPSTLMMISMEEDRPVKP
TMRRSASWNA*

Other information
Ka divergence:-0.339318KaKs divergence:-0.225092
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):1653Length 2 (bp):1653Length divergence:0
MFE 1 (kcal):-581.34MFE 2 (kcal):-588.3MFE divergence0.006