Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G007347-GRMZM2G081729
Species:maize
Duplication type:WGD
Function (paralog1):glycosyl hydrolase, family 43 protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.323429120983
Log2 mRNA fold difference:-1.6847224652619
Log2 TE fold difference:0.35658027326043
Sequences
Protein sequence

MGMRSRHPKALGFRWYPAATHRSLTLVLWSLAALVVVVNFHLLIIHKEEGENMSTHEIRR
SIMRELEVVEEEKFRLAPPRSRRNPRAVRRKGEKKSPTIVDEFLDESSAVHDMFFPELNT
AVDPINGGNDSMYFYYPGRIWLDTDGKPIQAHGGGVLYDKRTNTYFWYGENKDGKTYKAH
SKGADRVDIIGVSCYSSKDLWAWKNEGLVLRGEKNGTHDLHKSNVLERPKVIYNDRTGKY
VMWMHIDDANYTKASVGVAVSDSPTGPFTYLYSKRPHDCESRDMTIFKDDDGKAYLIYSS
EDNSELHIGPLTDDYLDVTDVMRRLLIAQHREAPALFKHEGTYYMVTSGCTGWAPNTALA
HAATSVMGPWETLGNPCVGGNEVFRSTTFFSQSTFVLPVPGLPGSFIFMADRWNPSDLRD
SRYVWLPLTIGGVPDEAADYSFMFPLWSRVSIYWHKRWRLPEEWRDS*

MGMRSRHPKALGFRCHPASHRSLTLALWSLAALVVVVNFHLLIVHKEDDESMSTHEIRRS
IMRELEVVEEEKFRLAPPRSRRNPRAVRRKGEKKKPTIVDEFLDESSAVHDMFFPELNTA
VDPINGANGSKYFYYPGRIWLDTDGKPIQAHGGGVLYDKRTTTYFFYGENKDGKTYRAHR
KGADRVDIIGVSCYSSKDLWTWKNEGLVLRGEEKNVTHDLHKSNVLERPKVIYNDRTGKY
VMWMHVDDANYTKASVGVAISDSPTGPFTYLYSKRPHDCESRDMTIFKDDDGKAYLIYSS
EDNSELHIGPLTDDYLDVTDAMRRLLIAQHREAPALFKHEGTYYMVTSGCTSWAPNTALA
HAATSVMGPWETLGNPCVGGNEVFRSTTFFSQSTFVLPVPGLPGSFIFMADRWNPSDLRD
SRYVWLPLTIGGVPDEAADYSFMFPLWSRVSIYWHRRWRLPEEWRDY*

Other information
Ka divergence:0.464094KaKs divergence:0.0537396
GC content 1 (%):51GC content 2 (%):52GC content divergence:0.01
Length 1 (bp):1404Length 2 (bp):1404Length divergence:0
MFE 1 (kcal):-519.6MFE 2 (kcal):-525.55MFE divergence0.006