Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G007647-GRMZM2G407044
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381801
Function (paralog2):acetolactate synthase/ amino acid binding protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.67963486395147
Log2 mRNA fold difference:1.3337387635594
Log2 TE fold difference:-0.69423587103272
Sequences
Protein sequence

MSLASSHHLRPSPAGPARRPGCPAPRVALCRPPGASPPYRGRCCTIVAAAAPAAGAGGEA
ASAPAAAVPAVAPGAAARDKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK
DKALFTIVVSGTDMVLNQVIEQLNKLVNVHSVEDLSKEPQVERELMLIKLNVEPDQRPEV
MVLVDIFRAKVVDISEKTLTIEVAGDPGKIAAVQRNLRKFGIKEICRTGKIALRREKIGA
TARFWRFSAASYPDLIEALPKKPLTSVNKTVNGSFVRPSNAGGDVYPVESYESSANQVLD
AHWGVLDDDDATGLCSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGSAEKEGISRI
TTVVPGTVESIGKLVQQLYKLIDVHEVHDITHSPFAERELMLIKVSVNTAARREILDIAE
IFRAKPIDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESKVDSKYLR
GYSLPL*

MSVASSHRLRPSPSGPARRPGSAAPRVAFWPAGASPPYRGRCTVVAAAAAAGAGGEASSA
PVAVSAVAPAGAARDKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL
FTIVVSGTDRVLNQVIEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLV
DIFRAKVVDISEKTLTMEVAGDPGKIAAVQRNLWKFGIKEICRTGKIALRRERIGATARF
WRFSAASYPDLIDALPKNPLTSVNRTVNGSFGQPSNAGGDVYPVESYESLSVNHVLDAHW
GVLDDDDATGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKEGISRITTV
VPGTVESIEKLVQQLYKLIDVHEVHDITHSPFAERELMLIKVSVNTAARKEILDIAEIFR
AKPVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESKVDSKYLRGYS
LPL*

Other information
Ka divergence:-0.143144KaKs divergence:-0.194294
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):1461Length 2 (bp):1452Length divergence:-0.003
MFE 1 (kcal):-538.94MFE 2 (kcal):-545.85MFE divergence0.006