Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G007914-GRMZM2G349988
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277416
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.24598654177502
Log2 mRNA fold difference:0.32833319496424
Log2 TE fold difference:-0.11133895180465
Sequences
Protein sequence

MARYEASAAAPGVDFHLPDEILAVIPTDPYEQLDVARKITSMAITSRVSRLEADSGRLRR
DLADRDHAEAELRARLADSDARLAAALDENAKLAKERDSLAATTKKLTRNLAKLEAFKKQ
LMKSLSEDNLLQLSETSQDHNGEDILTARVPYWKDEVCSSNTSSDTSIRSTITESIHGGG
YQFSIKTYVPPKLTPGSTPMISSSSGSPRAYSTGPPSPNFFSGPTSPTKARSEGQLTFSS
WQGSSSHQYSAPTSPQRHSFTGRPRIDGKEFFRQARTRLSYEQFGAFLANIKEFNAQKQS
REDTLSKAEEIFGTEHKDLYISFQNMLSRNQS*

MARNETAAAAAPGVDFHLPDEILAVIPTDPYEQLDVARKITSMAIASRVSRLEADAARLR
RDLADRDRAEADLRACLADSDARLATALDENAKLAKERDSLAATVKKLTRNLAKLEAFKK
QLMKSLSEDNLLQLSETSQDHNAEDLTARVPFWKDEVSSSNTSSDASSRSTITESVHDGG
YQFSITPYMPPKLTPGSTTMISSSSGSPRAYSTGPPSPKFLSGPTSPAKARSEGQLAFSS
WQGSSSHQYSAPTSPPQRRSFTGRPRIDGKEFFRQARTRLSYEQFGAFLANIKEFNAQKQ
SREDTLSKAEEIFGTEHNDLYISFQNMLNRN*

Other information
Ka divergence:0.0770227KaKs divergence:-0.155722
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):999Length 2 (bp):996Length divergence:-0.002
MFE 1 (kcal):-294.5MFE 2 (kcal):-313.36MFE divergence0.031