Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G008226-GRMZM2G366659
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.173121753545
Log2 mRNA fold difference:-0.30072325012159
Log2 TE fold difference:-0.79281017125466
Sequences
Protein sequence

MVSKSYSNLLDLTSGDGFDFRQPFKSLPRVVTSPGIISDTDWDTISDGDSVGSASSTERK
IIVANFLPLNCTRDETGVLSFSLDHDALLMQLKDSFSNETDVVYVGSLKVQVDPGEQDQV
AQKLLREYRCIPTFLPSDLQQQFYHGFCKQQLWPLFHYMLPICLDKGELFDRSLFQAYVR
ANKLFADKVMEAINADDDFVWVHDYHLMLLPTFLRKRLHRIKIGFFLHSPFPSSEIYRTL
PVRDEILKSLLNADLIGFQTFDYARHFLSCCSRLLGLHYESKRGYIGIEYFGRTVSLKIL
SVGVHIGRLESVLKLPATVSKVQEIEQRYKGKILMLGVDDMDIFKGISLKFLGLELLLDR
NPKLREKVVLVQIINPARSTGKDVQEAITEAVSVAERINTNYGSSSYKPVVLIDHHIPFY
EKIAFYAASDCCIVNAVRDGMNLVPYEYTVCRQGNEEIDKLRGLGKDTHHTSTLIVSEFV
GCSPSLSGAFRVNPWSVDDVADALCRATDLTESEKRLRHEKHYRYVSTHDVAYWARSFAQ
DLERACKDHYSRRCWAIGFGLNFRVIALSPGFRKLSSEHFVSSYNKASRRAIFLDYDGTL
VPQSSINKAPSEEVISVLNTLCNDPKNIVFIVSGRGRDSLDEWFSPCEKLGLAAEHGYFI
RWSKEAAWESSYSRPQQEWKHIAEPVMQVYTETTDGSSIESKESALVWHYLDADHDFGSF
QAKELQGHLERVLSNEPVVVKCGHYIVEVKPQGVSKGLAVNKLIHTLVKNGKAPDFLMCV
GNDRSDEDMFESINGMTSNAVLSPTMPELFACSVGQKPSKAKYYVDDTSEVIRLLKNVTR
IPSQRQDVSASHGRVTFRGVLDYVD*

MVSKSYSNLLDMTPGDGFDFRRPFKSLPRVVTSPSIISDHDWDSISDGDSVGSAFSIERK
IIVANFLPLNCTRDETGELSFSLDHDSLLMQLKDGFSNETDAVYVGSLKVHVDPREQDQV
AQKLLREYRCIPTFLPSDLQQQFYHGFCKQQLWPLFHYMLPICLDKGELFDRTLFQAYVR
ANKLFADKVMEAINTDDDYVWVHDYHLMLLPTFLRKRLHRIKIGFFLHSPFPSSEIYRTL
PVRDEILKSLLNADLIGFQTFDYARHFLSCCSRLLGLHYESKRGYIGIEYFGRTVSLKIL
SVGVHVGRLESVLKLPATVSKVEEIEQRYKGKILMLGVDDMDIFKGISLKLLALELLLDR
NPKLREKVVLVQIINPARSTGKDVQEAITEAVSVAERVNTKYGSSSYKPVVLIDNRIPFY
EKVAFYAASDCCIVNAVRDGMNLVPYEYTVCRQGNEEIDRVRGLDKDTHHTSTLIVSEFV
GCSPSLSGAFRVNPWSVDDVADALCRATDLSESEKRLRHEKHYRYVSTHDVAYWAHSFAQ
DLERACRDHYSRRCWAIGFGLNFRVIALSPGFRKLSSEHFVSSYNRASRRAIFLDYDGTL
VPQSSINKAPSEEVISILNTLCNDPKNVVFIVSGRGRDSLDEWFSPCEKLRLAAEHGYFI
RWSKEAAWESSYSSPRQEWKHIAEPVMQVYTETTDGSSVESKESALVWHYLDADHDFGSF
QAKELKDHLERVLSNEPVVVKCGHYIVEVKPQGVSKGRAVDKLIQALANNNGKAQDFLMC
VGNDRSDEDMFECINGMASNDVSSTTVPEVFACSVGQKPSKAKYYVDDTSEVIRLLRDAT
RFSSSQRREDVNASRGRVTFRDALDYVD*

Other information
Ka divergence:0.388482KaKs divergence:-0.0512895
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):2598Length 2 (bp):2607Length divergence:0.002
MFE 1 (kcal):-795.37MFE 2 (kcal):-843.73MFE divergence0.03