Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G008232-GRMZM2G158766
Species:maize
Duplication type:WGD
Function (paralog1):vacuolar ATP synthase subunit F
Function (paralog2):vacuolar ATP synthase subunit F

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.20774941585789
Log2 mRNA fold difference:0.57797781617385
Log2 TE fold difference:-0.37955141693818
Sequences
Protein sequence

MAGRANIPTNNSALIAIIADEDTVTGFLMAGVGNVDLRKKTNYLLVDNKTTVKQIEDAFK
EFTTREDIAIVLISQYIANMIRFLVDSYNKPVPAILEIPSKDHPYDPAHDSVLSRVKYLF
SAESVASDRR*

MAGRTNIPTNNSALIAIIADEDTVTGFLMAGVGNVDLRKKTNYLLVDNKTTVKQIEDAFK
EFTAREDIAIVLISQYIANMIRFLVDSYNKPVPAILEIPSKDHPYDPAHDSVLSRVKYLF
SAESVASDRR*

Other information
Ka divergence:0KaKs divergence:0.0556522
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):393Length 2 (bp):393Length divergence:0
MFE 1 (kcal):-125.25MFE 2 (kcal):-126.7MFE divergence0.006