Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G008290-GRMZM2G089873
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192886
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.90462692656
Log2 mRNA fold difference:-4.6198563284242
Log2 TE fold difference:0.69699576863724
Sequences
Protein sequence

MPLKRTSTPSGTLLLPLLNGTTNETTRKKAGRGNPLAARARAADTSTSTAATSQPVRGQQ
LGSSPTLAPPSAITALVRAHPPPRPAHHPPGPAAYLTPPPPGHSALSVSERPSLPPRTPR
RPAPSVTAPRPATETGRRDRQRPAAMGEDKKAGNKDAAGGDKKKDAGAGAAPQPIVLKVD
LHCAGCANKVRKAIKHAPGVESVTPDMAAGKVVVTGPADAVELKERIEARAKKPVQIVSA
GAGPPKKEKDKEKEKDKKADGGEKKADKEKGGGGGGEKKADKEKGGGEKKADKEKGGGEK
KADKEKGADKPKEEKKKPKEETVTLKIRLHCDGCIERIKRRISKIKGVKDVAFDAAKDLV
KVTGTMDGAALPAYLREKLSRDVEVVAPGKKDGGGGGDKKDKGAGDGGDKKKDGGGGGGG
GAEEKKDKAGAAAASASVAPPPLADAGMYQVPPHYGYAPYHQPAPGGYYGAAPPPNHHAG
FYPNGGGVHYPPAPAYAYGPTHLHAPQMFSDENPNACSVM*

MGEEKKTGKGGGGGGGDKKKDAGAGAAPQPIVLKVDLHCAGCANKVRKAIKARTRCVRGC
RRYAVSFLRWRGGGGVESVTPDMAAGKVVVTGPADAVQLKERIEARAKKPVQIVSAGAGS
PKKDKEKKADGGEKNAAKEKGGGDAEKKKADKKKGGGDGGEKNADKKKGGGGGDKKADKE
KGTGKPKEEEEEEEKPKEPKEETVTLKIQLHCDGCMDRIKRRICKIKGVKDVAFDAAKDL
VKVTGTMDAAVLPAYLREKLSRDVEVVAPGKKDGGGGGDKKGKGAGDGAEKKNKKKDGGA
EGKNDRAAAAAAAAASASVAPIPLADAGGMYLMPPHYGYMPYPPAPGGYYGAAPPPNHAG
FYANAGVHYPPPTAYGYGPAHLHAPQMFSDENPNACSVM*

Other information
Ka divergence:0.541446KaKs divergence:0.437207
GC content 1 (%):68GC content 2 (%):66GC content divergence:-0.015
Length 1 (bp):1563Length 2 (bp):1200Length divergence:-0.131
MFE 1 (kcal):-722.8MFE 2 (kcal):-577.2MFE divergence-0.112